DNA Polymerase epsilon subunit 3 Recombinant Protein Antigen

Images

 
There are currently no images for DNA Polymerase epsilon subunit 3 Protein (NBP2-13785PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNA Polymerase epsilon subunit 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLE3.

Source: E. coli

Amino Acid Sequence: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLE3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13785.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNA Polymerase epsilon subunit 3 Recombinant Protein Antigen

  • Arsenic-transactivated protein
  • asTP
  • CHARAC17arsenic transactivated protein
  • CHRAC-17
  • CHRAC17Ybl1
  • Chromatin accessibility complex 17 kDa protein
  • DNA polymerase epsilon p17 subunit
  • DNA polymerase epsilon subunit 3
  • DNA polymerase epsilon subunit p17
  • DNA polymerase II subunit 3
  • EC 2.7.7.7
  • histone fold protein CHRAC17
  • huCHRAC17
  • p17
  • polymerase (DNA directed), epsilon 3 (p17 subunit)
  • YBL1

Background

DNA polymerase epsilon (POLE) is an enzyme that helps catalyze in the polymerization of deoxyribonucleotides into a DNA strand. The C-terminus of DNA polymerase E subunit complexes with subunits B and C, whereas the N-terminal domain contains an active polymerase domain.

DNA Pol E antibodies are useful for DNA replication and repair studies and in research on mitosis and cell replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49672
Species: Hu
Applications: IHC,  IHC-P
NBP1-82454
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00057804-M10
Species: Hu
Applications: ELISA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-86784
Species: Hu
Applications: IHC,  IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
DRT100
Species: Hu
Applications: ELISA
NBP3-38209
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB

Publications for DNA Polymerase epsilon subunit 3 Protein (NBP2-13785PEP) (0)

There are no publications for DNA Polymerase epsilon subunit 3 Protein (NBP2-13785PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Polymerase epsilon subunit 3 Protein (NBP2-13785PEP) (0)

There are no reviews for DNA Polymerase epsilon subunit 3 Protein (NBP2-13785PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNA Polymerase epsilon subunit 3 Protein (NBP2-13785PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA Polymerase epsilon subunit 3 Products

Research Areas for DNA Polymerase epsilon subunit 3 Protein (NBP2-13785PEP)

Find related products by research area.

Blogs on DNA Polymerase epsilon subunit 3

There are no specific blogs for DNA Polymerase epsilon subunit 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNA Polymerase epsilon subunit 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLE3