DMRTC2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DMRTC2. Peptide sequence: EPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DMRTC2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DMRTC2 Antibody - BSA Free
Background
DMRTC2, or Doublesex- and mab-3-related transcription factor C2, contains a 39 kDa and a 24 kDa isoform, and is broadly associated with sexual development, though its specific function is unknown. Disease research is currently being conducted on the relationship between DMRTC2 and neuronitis. The protein is linked to the regulation of transcription, sex differentiation, and cell differentiation, and has been found to interact with several other proteins, including ABTB1, IRF9, IVNS1ABP, MCM6, and SREBF2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, PA, WB
Species: Hu
Applications: WB
Publications for DMRTC2 Antibody (NBP2-87281) (0)
There are no publications for DMRTC2 Antibody (NBP2-87281).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DMRTC2 Antibody (NBP2-87281) (0)
There are no reviews for DMRTC2 Antibody (NBP2-87281).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DMRTC2 Antibody (NBP2-87281) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DMRTC2 Products
Blogs on DMRTC2