DjC9 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKS |
| Predicted Species |
Rat (91%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DNAJC9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DjC9 Antibody - BSA Free
Background
DjC9 (DnaJ subfamily C member 9) belongs to the Hsp40 (heat shock protein 40) family of proteins that function as co-chaperones to Hsp70.Hsp40 proteins are classified into 3 main subfamilies (A, B, and C). The families are defined by the presence of particular domains which include a highly conserved alpha-helical N-terminal domain termed the J-domain, a glycine/phenylalanine-rich region, a cysteine-rich region, and a C-terminal beta-sheet containing domain. DjC9 is part of subfamily C that bears only the J-domain. DjC9 has been shown to interact with HSP70 through its J domain and activate its ATPase activity. DjC9 is also known as DnaJ protein SB73, HDJC9,DNAJC9,JDD1, and KIAA0974.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: WB
Publications for DjC9 Antibody (NBP2-33997) (0)
There are no publications for DjC9 Antibody (NBP2-33997).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DjC9 Antibody (NBP2-33997) (0)
There are no reviews for DjC9 Antibody (NBP2-33997).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DjC9 Antibody (NBP2-33997) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DjC9 Products
Research Areas for DjC9 Antibody (NBP2-33997)
Find related products by research area.
|
Blogs on DjC9