DjC9 Antibody - BSA Free

Western Blot: DjC9 Antibody [NBP2-33997] - Analysis using Anti-DNAJC9 antibody NBP2-33997 (A) shows similar pattern to independent antibody NBP1-87903 (B).

Immunocytochemistry/Immunofluorescence: DjC9 Antibody [NBP2-33997] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm, plasma membrane & cytosol.

Immunohistochemistry-Paraffin: DjC9 Antibody [NBP2-33997] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Western Blot: DjC9 Antibody [NBP2-33997] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DjC9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKS
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJC9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DjC9 Protein (NBP2-33997PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DjC9 Antibody - BSA Free

• DnaJ (Hsp40) homolog, subfamily C, member 9
• dnaJ homolog subfamily C member 9

Background

DjC9 (DnaJ subfamily C member 9) belongs to the Hsp40 (heat shock protein 40) family of proteins that function as co-chaperones to Hsp70.Hsp40 proteins are classified into 3 main subfamilies (A, B, and C). The families are defined by the presence of particular domains which include a highly conserved alpha-helical N-terminal domain termed the J-domain, a glycine/phenylalanine-rich region, a cysteine-rich region, and a C-terminal beta-sheet containing domain. DjC9 is part of subfamily C that bears only the J-domain. DjC9 has been shown to interact with HSP70 through its J domain and activate its ATPase activity. DjC9 is also known as DnaJ protein SB73, HDJC9,DNAJC9,JDD1, and KIAA0974.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJC9
• Uniprot:
  • Q8WXX5(Human)