DjC9 Antibody

Images

 
Independent Antibodies: Western Blot: DjC9 Antibody [NBP1-87903] - Analysis using Anti-DNAJC9 antibody NBP1-87903 (A) shows similar pattern to independent antibody NBP2-33997 (B).
Western Blot: DjC9 Antibody [NBP1-87903] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: DjC9 Antibody [NBP1-87903] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: DjC9 Antibody [NBP1-87903] - Staining of human appendix shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

DjC9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYT
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DjC9 Protein (NBP1-87903PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DjC9 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 9
  • dnaJ homolog subfamily C member 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02996
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3926
Species: Hu, Mu, Rt
Applications: WB
H00010049-M01
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15238
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005532-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-67635
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
NBP1-89345
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00118490-P01
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for DjC9 Antibody (NBP1-87903) (0)

There are no publications for DjC9 Antibody (NBP1-87903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DjC9 Antibody (NBP1-87903) (0)

There are no reviews for DjC9 Antibody (NBP1-87903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DjC9 Antibody (NBP1-87903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DjC9 Products

Bioinformatics Tool for DjC9 Antibody (NBP1-87903)

Discover related pathways, diseases and genes to DjC9 Antibody (NBP1-87903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DjC9 Antibody (NBP1-87903)

Discover more about diseases related to DjC9 Antibody (NBP1-87903).
 

Pathways for DjC9 Antibody (NBP1-87903)

View related products by pathway.

Blogs on DjC9

There are no specific blogs for DjC9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DjC9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC9