DIS3L2 Antibody

Images

 
Western Blot: DIS3L2 Antibody [NBP1-80479] - Titration: 1.25ug/ml, Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: DIS3L2 Antibody [NBP1-80479] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DIS3L2 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human MGC42174. Peptide sequence: WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DIS3L2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against MGC42174 and was validated on Western Blot and immunohistochemistry.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DIS3L2 Antibody

  • DIS3 mitotic control homolog (S. cerevisiae)-like 2
  • DIS3-like exonuclease 2
  • FAM6A
  • member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85838
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3127
Species: Hu
Applications: WB, IHC, IP
NBP1-86710
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81451
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00022894-B01P
Species: Hu, Ch
Applications: WB, ELISA, ICC/IF
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5784
Species: Hu
Applications: WB
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58529
Species: Hu
Applications: ICC/IF
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85142
Species: Hu
Applications: IHC, IHC-P
H00115752-B01P
Species: Hu
Applications: WB
NBP1-85126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80479
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DIS3L2 Antibody (NBP1-80479) (0)

There are no publications for DIS3L2 Antibody (NBP1-80479).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIS3L2 Antibody (NBP1-80479) (0)

There are no reviews for DIS3L2 Antibody (NBP1-80479). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIS3L2 Antibody (NBP1-80479) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIS3L2 Products

Bioinformatics Tool for DIS3L2 Antibody (NBP1-80479)

Discover related pathways, diseases and genes to DIS3L2 Antibody (NBP1-80479). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIS3L2 Antibody (NBP1-80479)

Discover more about diseases related to DIS3L2 Antibody (NBP1-80479).
 

Pathways for DIS3L2 Antibody (NBP1-80479)

View related products by pathway.

Blogs on DIS3L2.

DIS3L2: Uridiylation Control of the Lin28-Let-7 Differentiation Pathway
The Lin28-Let-7 stem cell differentiation regulatory pathway is responsible for maintaining stem cell pluripotency. Specifically, Lin28 causes uridiylation of the let-7 miRNA precursor, which prevents differentiation processing by Dicer. Instead, the...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIS3L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIS3L2
Uniprot