DIS3L2 Antibody


Western Blot: DIS3L2 Antibody [NBP1-80479] - Titration: 1.25ug/ml, Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: DIS3L2 Antibody [NBP1-80479] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.

Product Details

Reactivity Hu, Hu, Po, BvSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

DIS3L2 Antibody Summary

Synthetic peptide directed towards the N terminal of human MGC42174. Peptide sequence: WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF
Predicted Species
Human (100%), Porcine (93%), Bovine (93%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against MGC42174 and was validated on Western Blot and immunohistochemistry.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DIS3L2 Antibody

  • DIS3 mitotic control homolog (S. cerevisiae)-like 2
  • DIS3-like exonuclease 2
  • FAM6A
  • member A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Ch
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Hu, Po, Bv
Applications: WB, IHC, IHC-P

Publications for DIS3L2 Antibody (NBP1-80479) (0)

There are no publications for DIS3L2 Antibody (NBP1-80479).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIS3L2 Antibody (NBP1-80479) (0)

There are no reviews for DIS3L2 Antibody (NBP1-80479). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIS3L2 Antibody (NBP1-80479) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DIS3L2 Products

Bioinformatics Tool for DIS3L2 Antibody (NBP1-80479)

Discover related pathways, diseases and genes to DIS3L2 Antibody (NBP1-80479). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIS3L2 Antibody (NBP1-80479)

Discover more about diseases related to DIS3L2 Antibody (NBP1-80479).

Pathways for DIS3L2 Antibody (NBP1-80479)

View related products by pathway.

Blogs on DIS3L2.

DIS3L2: Uridiylation Control of the Lin28-Let-7 Differentiation Pathway
The Lin28-Let-7 stem cell differentiation regulatory pathway is responsible for maintaining stem cell pluripotency. Specifically, Lin28 causes uridiylation of the let-7 miRNA precursor, which prevents differentiation processing by Dicer. Instead, the...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DIS3L2 Antibody and receive a gift card or discount.


Gene Symbol DIS3L2