Recombinant Human DHX8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DHX8 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human DHX8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW

Protein/Peptide Type
Partial Recombinant Protein
Gene
DHX8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DHX8 Protein

  • DDX8ATP-dependent RNA helicase DHX8
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 (RNA helicase)
  • DEAH (Asp-Glu-Ala-His) box polypeptide 8
  • DEAH box protein 8
  • DEAH-box protein 8
  • EC 3.6.1
  • EC 3.6.4.13
  • HRH1RNA helicase HRH1
  • PRP22
  • PRPF22

Background

DHX8 - DEAH (Asp-Glu-Ala-His) box polypeptide 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80876
Species: Hu
Applications: WB, IHC, IHC-P
NB100-586
Species: Hu
Applications: WB, IP
NB600-812
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-58541
Species: Hu
Applications: ICC/IF
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NLS476
Species: Hu, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP1-92297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00079092-T01
Species: Hu
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
AF7637
Species: Hu
Applications: WB
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-58978
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, Sh
Applications: ELISA, IHC-P
AF5745
Species: Hu
Applications: WB, IHC

Publications for DHX8 Partial Recombinant Protein (H00001659-Q01) (0)

There are no publications for DHX8 Partial Recombinant Protein (H00001659-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX8 Partial Recombinant Protein (H00001659-Q01) (0)

There are no reviews for DHX8 Partial Recombinant Protein (H00001659-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHX8 Partial Recombinant Protein (H00001659-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DHX8 Products

Bioinformatics Tool for DHX8 Partial Recombinant Protein (H00001659-Q01)

Discover related pathways, diseases and genes to DHX8 Partial Recombinant Protein (H00001659-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX8 Partial Recombinant Protein (H00001659-Q01)

Discover more about diseases related to DHX8 Partial Recombinant Protein (H00001659-Q01).
 

Pathways for DHX8 Partial Recombinant Protein (H00001659-Q01)

View related products by pathway.

Blogs on DHX8

There are no specific blogs for DHX8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DHX8 Antibody
NB100-1713
SNW1 Antibody
NBP1-88523

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DHX8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX8