DHX34 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DHX34 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DHX34.
  
  

  Source: E. coli

  Amino Acid Sequence: GVCFRLYAESDYDAFAPYPVPEIRRVALDSLVLQMKSMSVGDPRTFPFIEPPPPASLETAILYLRDQGALDSSEALTPIGSLLAQLPVDVV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DHX34
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91833.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DHX34 Recombinant Protein Antigen

• DDX34
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 34
• DEAH (Asp-Glu-Ala-His) box polypeptide 34
• DEAH box protein 34
• HRH1
• KIAA0134

Background

DHX34, also known as Probable ATP-dependent RNA helicase DHX34, is a 128.1 kDa 1,143 amino acid protein that is utilized in a number of cellular processes, such as transcription and translation, as a member of the DEAD box protein family. Current research is exploring the use of the protein with diseases such as asthma and dermatitis. The protein interacts with RPS6KA6, POLA2, UBC, and GSK3B in ATP-binding pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DHX34