DHX30 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DHX30 Antibody [NBP1-85270] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: DHX30 Antibody [NBP1-85270] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DHX30 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DHX30 Antibody - BSA Free (NBP1-85270) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSPA
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHX30
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DHX30 Protein (NBP1-85270PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DHX30 Antibody - BSA Free

• ATP-dependent RNA helicase DHX30
• DDX30
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 30
• DEAH (Asp-Glu-Ala-His) box polypeptide 30
• DEAH box protein 30
• EC 3.6.1
• EC 3.6.4.13
• FLJ11214
• KIAA0890RETCOR
• putative ATP-dependent RNA helicase DHX30
• retina co-repressor

Background

DHX30 (DEAH-box polypeptide 30) is a member of the DEAD box family of proteins that possesses several conserved motifs which include the highly conserved DEAD (Asp-Glu-Ala-Asp) amino acid sequence motif. The major activity of DEAD box proteins is to function as ATP-dependent RNA helicases. As helicases, DEAD proteins play an important role in all aspects of RNA metabolism and function which include pre-mRNA splicing, RNA synthesis, RNA degradation, RNA export, RNA translation, RNA secondary structure formation, ribosome biogenesis, and the assembly of RNP complexes. DHX30 has been implicated to be involved in the packaging of HIV-1 viral RNA and HIV-1 replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHX30