![Western Blot: DHRSX Antibody [H00207063-B01P] - Analysis of DHRSX expression in human liver.](http://images.novusbio.com/fullsize/DHRSX-Antibody-Western-Blot-H00207063-B01P-img0002.jpg "Western Blot: DHRSX Antibody [H00207063-B01P] - Analysis of DHRSX expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse DHRSX Antibody - Azide and BSA Free (H00207063-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | DHRSX (NP_660160.1, 1 a.a. - 330 a.a.) full-length human protein. MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | DHRSX |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for Western Blot, Functional, Immunofluorescence |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Western Blot SPRY3 Antibody [Unconjugated]](https://images.novusbio.com/images2/SPRY3_AF5735_Western_Blot_5827.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DHRSX Antibody (H00207063-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DHRSX |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: DHRSX Antibody [H00207063-B01P] - Analysis of purified antibody to DHRSX on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/DHRSX-Antibody-Immunocytochemistry-Immunofluorescence-H00207063-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: DHRSX Antibody [H00207063-B01P] - Analysis of purified antibody to DHRSX on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: DHRSX Antibody [H00207063-B01P] - Analysis of DHRSX expression in transfected 293T cell line by DHRSX polyclonal antibody. Lane 1: DHRSX transfected lysate(36.3 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/DHRSX-Antibody-Western-Blot-H00207063-B01P-img0003.jpg "Western Blot: DHRSX Antibody [H00207063-B01P] - Analysis of DHRSX expression in transfected 293T cell line by DHRSX polyclonal antibody. Lane 1: DHRSX transfected lysate(36.3 KDa). Lane 2: Non-transfected lysate.")
![Immunocytochemistry GM-CSFR alpha Antibody (698423) [Unconjugated]](https://images.novusbio.com/images2/GM-CSF_R_alpha_MAB6130_Immunocytochemistry_11149.jpg)
![Flow Cytometry GM-CSFR alpha Antibody (698423) [Unconjugated]](https://images.novusbio.com/images2/GM-CSF_R_alpha_MAB6130_Flow_Cytometry_11215.jpg)
![Neutralization GM-CSFR alpha Antibody (698423) [Unconjugated]](https://images.novusbio.com/images2/GM-CSF_R_alpha_MAB6130_Block_Neutralize_11320.jpg)
![Neutralization IL-3R alpha/CD123 Antibody (32703) [Unconjugated]](https://images.novusbio.com/images2/IL-3_R_alpha_MAB301_Block_Neutralize_2301.jpg)
![Immunocytochemistry IL-3R alpha/CD123 Antibody (32703) [Unconjugated]](https://images.novusbio.com/images2/IL-3_R_alpha_MAB301_Immunocytochemistry_6602.jpg)
![Immunohistochemistry IL-3R alpha/CD123 Antibody (32703) [Unconjugated]](https://images.novusbio.com/images2/IL-3_R_alpha_MAB301_Immunohistochemistry_6988.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")