DGCR6L Antibody


Western Blot: DGCR6L Antibody [NBP1-79875] - Human Fetal Brain Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

DGCR6L Antibody Summary

Synthetic peptide directed towards the C terminal of human DGCR6LThe immunogen for this antibody is DGCR6L. Peptide sequence QQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against DGCR6L and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DGCR6L Antibody

  • DiGeorge syndrome critical region 6-like protein
  • DiGeorge syndrome critical region gene 6 like
  • DiGeorge syndrome critical region gene 6-like
  • FLJ10666
  • protein DGCR6L


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IF
Species: Hu
Applications: WB

Publications for DGCR6L Antibody (NBP1-79875) (0)

There are no publications for DGCR6L Antibody (NBP1-79875).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGCR6L Antibody (NBP1-79875) (0)

There are no reviews for DGCR6L Antibody (NBP1-79875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DGCR6L Antibody (NBP1-79875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for DGCR6L Antibody (NBP1-79875)

Discover related pathways, diseases and genes to DGCR6L Antibody (NBP1-79875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGCR6L Antibody (NBP1-79875)

Discover more about diseases related to DGCR6L Antibody (NBP1-79875).

Pathways for DGCR6L Antibody (NBP1-79875)

View related products by pathway.

PTMs for DGCR6L Antibody (NBP1-79875)

Learn more about PTMs related to DGCR6L Antibody (NBP1-79875).

Blogs on DGCR6L

There are no specific blogs for DGCR6L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DGCR6L Antibody and receive a gift card or discount.


Gene Symbol DGCR6L