DDX50 Antibody

Images

 
Western Blot: DDX50 Antibody [NBP1-83311] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: DDX50 Antibody [NBP1-83311] - Staining of human cell line A-431 shows positivity in nucleoli.
Immunohistochemistry-Paraffin: DDX50 Antibody [NBP1-83311] - Staining of human vulva/anal skin shows moderate nucleolar positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX50 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWILSVPAKLPEIEEYYDGNTSSNSRQRSGWSSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX50
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX50 Protein (NBP1-83311PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX50 Antibody

  • ATP-dependent RNA helicase DDX50
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
  • DEAD box protein 50
  • EC 3.6.1
  • EC 3.6.4.13
  • GU2
  • GUB
  • gu-beta
  • MGC3199
  • Nucleolar protein Gu2
  • RH-II/GuB
  • RNA helicase II/Gu beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1718
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054606-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for DDX50 Antibody (NBP1-83311) (0)

There are no publications for DDX50 Antibody (NBP1-83311).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX50 Antibody (NBP1-83311) (0)

There are no reviews for DDX50 Antibody (NBP1-83311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX50 Antibody (NBP1-83311) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX50 Products

Bioinformatics Tool for DDX50 Antibody (NBP1-83311)

Discover related pathways, diseases and genes to DDX50 Antibody (NBP1-83311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX50 Antibody (NBP1-83311)

Discover more about diseases related to DDX50 Antibody (NBP1-83311).
 

Pathways for DDX50 Antibody (NBP1-83311)

View related products by pathway.

PTMs for DDX50 Antibody (NBP1-83311)

Learn more about PTMs related to DDX50 Antibody (NBP1-83311).

Blogs on DDX50

There are no specific blogs for DDX50, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX50