DDX49 Antibody


There are currently no images for DDX49 Antibody (NBP1-69713).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

DDX49 Antibody Summary

Synthetic peptides corresponding to DDX49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49) The peptide sequence was selected from the N terminal of DDX49. Peptide sequence ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DDX49 and was validated on Western blot.
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DDX49 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 49
  • DEAD box protein 49
  • EC 3.6.1
  • EC
  • FLJ10432
  • probable ATP-dependent RNA helicase DDX49
  • R27090_2


The function of Anti-DDX49 has not yet been determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Bv, Pm
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
Species: Hu, Pm, Mu(-)
Applications: WB, ICC/IF

Publications for DDX49 Antibody (NBP1-69713) (0)

There are no publications for DDX49 Antibody (NBP1-69713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX49 Antibody (NBP1-69713) (0)

There are no reviews for DDX49 Antibody (NBP1-69713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX49 Antibody (NBP1-69713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DDX49 Products

Bioinformatics Tool for DDX49 Antibody (NBP1-69713)

Discover related pathways, diseases and genes to DDX49 Antibody (NBP1-69713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DDX49

There are no specific blogs for DDX49, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DDX49 Antibody and receive a gift card or discount.


Gene Symbol DDX49