DDX49 Antibody

Images

 
There are currently no images for DDX49 Antibody (NBP1-69713).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX49 Antibody Summary

Immunogen
Synthetic peptides corresponding to DDX49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49) The peptide sequence was selected from the N terminal of DDX49. Peptide sequence ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX49
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DDX49 and was validated on Western blot.
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DDX49 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 49
  • DEAD box protein 49
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ10432
  • probable ATP-dependent RNA helicase DDX49
  • R27090_2

Background

The function of Anti-DDX49 has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP1-32670
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056949-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13896
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-51927
Species: Hu
NBP2-39036
Species: Hu
Applications: IHC, IHC-P
NBP2-24501
Species: Hu, Mu, Bv, Pm
Applications: WB, IHC-P
NBP1-89663
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBP2-56928
Species: Hu
Applications: WB, ICC/IF
NB100-176
Species: Hu, Pm, Mu(-)
Applications: WB, ICC/IF

Publications for DDX49 Antibody (NBP1-69713) (0)

There are no publications for DDX49 Antibody (NBP1-69713).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX49 Antibody (NBP1-69713) (0)

There are no reviews for DDX49 Antibody (NBP1-69713). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX49 Antibody (NBP1-69713) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX49 Products

Bioinformatics Tool for DDX49 Antibody (NBP1-69713)

Discover related pathways, diseases and genes to DDX49 Antibody (NBP1-69713). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DDX49

There are no specific blogs for DDX49, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX49 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX49
Uniprot