DDI2 Antibody


Western Blot: DDI2 Antibody [NBP2-47493] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/ Immunofluorescence: DDI2 Antibody [NBP2-47493] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DDI2 Antibody [NBP2-47493] - Staining of human prostate shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

DDI2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EGELPECARLAYGAGREDVRPEEIADQELAEALQKSAEDAERQKP
Specificity of human DDI2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDI2 Protein (NBP2-47493PEP)

Reactivity Notes

Rat (84%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DDI2 Antibody

  • DDI1, DNA-damage inducible 1, homolog 2 (S. cerevisiae)
  • DDI1, DNA-damage inducible 1, homolog 2
  • DNA-damage inducible 1 homolog 2 (S. cerevisiae)
  • DNA-damage inducible protein 2 (DDI2)
  • MGC14844
  • protein DDI1 homolog 2
  • RP4-680D5.5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for DDI2 Antibody (NBP2-47493) (0)

There are no publications for DDI2 Antibody (NBP2-47493).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDI2 Antibody (NBP2-47493) (0)

There are no reviews for DDI2 Antibody (NBP2-47493). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDI2 Antibody (NBP2-47493) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP2-47493

Bioinformatics Tool for DDI2 Antibody (NBP2-47493)

Discover related pathways, diseases and genes to DDI2 Antibody (NBP2-47493). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDI2 Antibody (NBP2-47493)

Discover more about diseases related to DDI2 Antibody (NBP2-47493).

Blogs on DDI2

There are no specific blogs for DDI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DDI2 Antibody and receive a gift card or discount.


Gene Symbol DDI2