DDI2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DDI2 Antibody [NBP2-47492] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry: DDI2 Antibody [NBP2-47492] - Staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDI2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGL
Specificity
Specificity of human DDI2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDI2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDI2 Protein (NBP2-47492PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDI2 Antibody

  • DDI1, DNA-damage inducible 1, homolog 2 (S. cerevisiae)
  • DDI1, DNA-damage inducible 1, homolog 2
  • DNA-damage inducible 1 homolog 2 (S. cerevisiae)
  • DNA-damage inducible protein 2 (DDI2)
  • MGC14844
  • protein DDI1 homolog 2
  • RP4-680D5.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86944
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-77101
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006947-M12
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92084
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-81657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-56547
Species: Hu
Applications: ICC/IF

Publications for DDI2 Antibody (NBP2-47492) (0)

There are no publications for DDI2 Antibody (NBP2-47492).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDI2 Antibody (NBP2-47492) (0)

There are no reviews for DDI2 Antibody (NBP2-47492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DDI2 Antibody (NBP2-47492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-47492

Bioinformatics Tool for DDI2 Antibody (NBP2-47492)

Discover related pathways, diseases and genes to DDI2 Antibody (NBP2-47492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDI2 Antibody (NBP2-47492)

Discover more about diseases related to DDI2 Antibody (NBP2-47492).

Blogs on DDI2

There are no specific blogs for DDI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDI2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDI2