Recombinant Human DCK Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-100 of Human DCK partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:WMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL |
Protein/Peptide Type |
Partial Recombinant Protein |
Gene |
DCK |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human DCK Protein
Background
DCK - deoxycytidine kinase
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Publications for DCK Partial Recombinant Protein (H00001633-Q01) (0)
There are no publications for DCK Partial Recombinant Protein (H00001633-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DCK Partial Recombinant Protein (H00001633-Q01) (0)
There are no reviews for DCK Partial Recombinant Protein (H00001633-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DCK Partial Recombinant Protein (H00001633-Q01) (0)
Additional DCK Products
Blogs on DCK