DARS Antibody (2F11)

Images

 
Western Blot: DARS Antibody (2F11) [H00001615-M01] - DARS monoclonal antibody (M01), clone 2F11 Analysis of DARS expression in HeLa.
Immunohistochemistry-Paraffin: DARS Antibody (2F11) [H00001615-M01] - Analysis of monoclonal antibody to DARS on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: DARS Antibody (2F11) [H00001615-M01] - Analysis of DARS over-expressed 293 cell line, cotransfected with DARS Validated Chimera RNAi ( Cat # H00001615-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: DARS Antibody (2F11) [H00001615-M01] - Analysis of DARS expression in transfected 293T cell line by DARS monoclonal antibody (M01), clone 2F11.Lane 1: DARS transfected lysate(57.1 KDa).Lane 2: ...read more
Sandwich ELISA: DARS Antibody (2F11) [H00001615-M01] - Detection limit for recombinant GST tagged DARS is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, RNAi
Clone
2F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

DARS Antibody (2F11) Summary

Immunogen
DARS (NP_001340 393 a.a. - 500 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KYPLAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLGLHNVRQTSMFPRDPKRLT
Specificity
DARS - aspartyl-tRNA synthetase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DARS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.
Publications
Read Publication using H00001615-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DARS Antibody (2F11)

  • aspartate tRNA ligase 1, cytoplasmic
  • Aspartate--tRNA ligase
  • aspartyl-tRNA synthetase
  • aspartyl-tRNA synthetase, cytoplasmic
  • aspRS
  • Cell proliferation-inducing gene 40 protein
  • cell proliferation-inducing protein 40
  • DKFZp781B11202
  • EC 6.1.1.12
  • MGC111579

Background

Aspartyl-tRNA synthetase (DARS) is part of a multienzyme complex of aminoacyl-tRNA synthetases. Aspartyl-tRNA synthetase charges its cognate tRNA with aspartate during protein biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82077
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-90079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33807
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55125
Species: Hu
Applications: WB, ICC/IF
NBP2-38035
Species: Hu
Applications: IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20567
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57136
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-45808
Species: Hu
Applications: IHC

Publications for DARS Antibody (H00001615-M01)(1)

Reviews for DARS Antibody (H00001615-M01) (0)

There are no reviews for DARS Antibody (H00001615-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DARS Antibody (H00001615-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DARS Products

Bioinformatics Tool for DARS Antibody (H00001615-M01)

Discover related pathways, diseases and genes to DARS Antibody (H00001615-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DARS Antibody (H00001615-M01)

Discover more about diseases related to DARS Antibody (H00001615-M01).
 

Pathways for DARS Antibody (H00001615-M01)

View related products by pathway.

Blogs on DARS

There are no specific blogs for DARS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DARS Antibody (2F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol DARS
Entrez
OMIM
Uniprot