Recombinant Human DAP Kinase 1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human DAP Kinase 1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1211-1310 of Human DAP Kinase 1

Source: Wheat Germ

Amino Acid Sequence: LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DAPK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DAP Kinase 1 Protein

  • DAPKDAP kinase 1
  • death-associated protein kinase 1
  • DKFZp781I035
  • EC 2.7.11
  • EC 2.7.11.1

Background

DAPK1 - death-associated protein kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45603
Species: Hu
Applications: WB, Flow, IHC
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01) (0)

There are no publications for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01) (0)

There are no reviews for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAP Kinase 1 Products

Bioinformatics Tool for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01)

Discover related pathways, diseases and genes to DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01)

Discover more about diseases related to DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01).
 

Pathways for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01)

View related products by pathway.

PTMs for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01)

Learn more about PTMs related to DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01).
 

Research Areas for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01)

Find related products by research area.

Blogs on DAP Kinase 1

There are no specific blogs for DAP Kinase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DAP Kinase 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DAPK1