Recombinant Human DAP Kinase 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DAP Kinase 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human DAPK1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DAPK1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DAP Kinase 1 Protein

  • DAPKDAP kinase 1
  • death-associated protein kinase 1
  • DKFZp781I035
  • EC 2.7.11
  • EC 2.7.11.1

Background

DAPK1 - death-associated protein kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01) (0)

There are no publications for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01) (0)

There are no reviews for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAP Kinase 1 Products

Bioinformatics Tool for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01)

Discover related pathways, diseases and genes to DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01)

Discover more about diseases related to DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01).
 

Pathways for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01)

View related products by pathway.

PTMs for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01)

Learn more about PTMs related to DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01).
 

Research Areas for DAP Kinase 1 Partial Recombinant Protein (H00001612-Q01)

Find related products by research area.

Blogs on DAP Kinase 1

There are no specific blogs for DAP Kinase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DAP Kinase 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DAPK1