D4S234E Antibody


Western Blot: D4S234E Antibody [NBP1-87425] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: D4S234E Antibody [NBP1-87425] - Staining of human cell line A-431 shows positivity in mitochondria.
Immunohistochemistry-Paraffin: D4S234E Antibody [NBP1-87425] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
Western Blot: D4S234E Antibody [NBP1-87425] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Product Discontinued
View other related D4S234E Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

D4S234E Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CPDGFVLKNTQCIPEGLESYYAEQDSSAREKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKS
Specificity of human, mouse, rat D4S234E antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
D4S234E Protein (NBP1-87425PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for D4S234E Antibody

  • carboxyterminally EE-tagged neuron-enriched endosomal 21 kDa protein
  • D4S234Brain neuron cytoplasmic protein 1
  • DNA segment on chromosome 4 (unique) 234 expressed sequence
  • NEEP21
  • neuron-specific protein family member 1
  • NSG1
  • P21


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for D4S234E Antibody (NBP1-87425) (0)

There are no publications for D4S234E Antibody (NBP1-87425).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for D4S234E Antibody (NBP1-87425) (0)

There are no reviews for D4S234E Antibody (NBP1-87425). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for D4S234E Antibody (NBP1-87425) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional D4S234E Products

Bioinformatics Tool for D4S234E Antibody (NBP1-87425)

Discover related pathways, diseases and genes to D4S234E Antibody (NBP1-87425). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for D4S234E Antibody (NBP1-87425)

Discover more about diseases related to D4S234E Antibody (NBP1-87425).

Pathways for D4S234E Antibody (NBP1-87425)

View related products by pathway.

PTMs for D4S234E Antibody (NBP1-87425)

Learn more about PTMs related to D4S234E Antibody (NBP1-87425).

Research Areas for D4S234E Antibody (NBP1-87425)

Find related products by research area.

Blogs on D4S234E

There are no specific blogs for D4S234E, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our D4S234E Antibody and receive a gift card or discount.


Gene Symbol NSG1