Recombinant Human Cytosolic Sulfotransferase 4A1/SULT4A1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cytosolic Sulfotransferase 4A1/SULT4A1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human SULT4A1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK

Protein/Peptide Type
Partial Recombinant Protein
Gene
SULT4A1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytosolic Sulfotransferase 4A1/SULT4A1 Protein

  • Brain sulfotransferase-like protein
  • BRSTL1
  • BR-STL-1
  • Cytosolic Sulfotransferase 4A1
  • EC 2.8.2.-
  • hBR-STL
  • hBR-STL-1MGC40032
  • nervous system cytosolic sulfotransferase
  • Nervous system sulfotransferase
  • NST
  • ST4A1
  • sulfotransferase 4A1
  • sulfotransferase family 4A, member 1
  • sulfotransferase-related protein
  • SULT4A1
  • SULTX3
  • SULTX3DJ388M5.3

Background

This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1619
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBL1-16115
Species: Hu
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-59448
Species: Hu
Applications: WB
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
H00025830-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01) (0)

There are no publications for Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01) (0)

There are no reviews for Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytosolic Sulfotransferase 4A1/SULT4A1 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01)

Discover more about diseases related to Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01).
 

Pathways for Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01)

Learn more about PTMs related to Cytosolic Sulfotransferase 4A1/SULT4A1 Partial Recombinant Protein (H00025830-Q01).

Blogs on Cytosolic Sulfotransferase 4A1/SULT4A1

There are no specific blogs for Cytosolic Sulfotransferase 4A1/SULT4A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytosolic Sulfotransferase 4A1/SULT4A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT4A1
Entrez