Recombinant Human Cytosolic Sulfotransferase 1C2/SULT1C2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cytosolic Sulfotransferase 1C2/SULT1C2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-296 of Human SULT1C1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SULT1C2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytosolic Sulfotransferase 1C2/SULT1C2 Protein

  • Cytosolic Sulfotransferase 1C2
  • cytosolic, 1C, member 1
  • EC 2.8.2
  • EC 2.8.2.-
  • EC 2.8.2.1
  • EC 2.8.2.2
  • humSULTC2
  • ST1C1
  • ST1C2
  • Sulfotransferase 1C1
  • sulfotransferase family, cytosolic, 1C, member 2
  • SULT1C#1
  • SULT1C1
  • SULT1C2

Background

SULT1C1( AAH05353, 1 a.a. - 297 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5545
Species: Hu
Applications: WB
NBP2-31904
Species: Hu
Applications: WB, IHC, IHC-P
AF5828
Species: Hu
Applications: WB, ICC, Neut
MAB5826
Species: Hu
Applications: WB, IHC
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-59786
Species: Hu
Applications: WB
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
AF6174
Species: Hu
Applications: WB, IHC, IP
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88813
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-86142
Species: Hu
Applications: WB, IHC, IHC-P
H00006819-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01) (0)

There are no publications for Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01) (0)

There are no reviews for Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytosolic Sulfotransferase 1C2/SULT1C2 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01)

Discover more about diseases related to Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01).
 

Pathways for Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01)

Learn more about PTMs related to Cytosolic Sulfotransferase 1C2/SULT1C2 Recombinant Protein (H00006819-P01).

Blogs on Cytosolic Sulfotransferase 1C2/SULT1C2

There are no specific blogs for Cytosolic Sulfotransferase 1C2/SULT1C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytosolic Sulfotransferase 1C2/SULT1C2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT1C2
Entrez