Cysteine Conjugate beta-Lyase/CCBL1 Antibody (1B12)

Images

 
Western Blot: Cysteine Conjugate beta-Lyase/CCBL1 Antibody (1B12) [H00000883-M02] - Analysis of CCBL1 expression in transfected 293T cell line by CCBL1 monoclonal antibody (M02), clone 1B12.Lane 1: CCBL1 transfected ...read more
Immunocytochemistry/ Immunofluorescence: Cysteine Conjugate beta-Lyase/CCBL1 Antibody (1B12) [H00000883-M02] - Analysis of monoclonal antibody to CCBL1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Cysteine Conjugate beta-Lyase/CCBL1 Antibody (1B12) [H00000883-M02] - Detection limit for recombinant GST tagged CCBL1 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cysteine Conjugate beta-Lyase/CCBL1 Antibody (1B12) Summary

Immunogen
CCBL1 (AAH33685, 1 a.a. - 374 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELWP
Specificity
CCBL1 - cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase) (1B12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCBL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (1B12)

  • CCBL1
  • Cysteine Conjugate betaLyase
  • Cysteine Conjugate beta-Lyase
  • cysteine conjugate-beta lyase, cytoplasmic
  • cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K
  • Cysteine-S-conjugate beta-lyase
  • EC 2.6.1.64
  • EC 2.6.1.7
  • EC 4.4.1.13
  • FLJ95217
  • Glutamine Transaminase K
  • glutamine-phenylpyruvate aminotransferase
  • Glutamine--phenylpyruvate transaminase
  • GTKMGC29624
  • KAT1
  • KATI
  • KATIbeta-lysase, kidney
  • Kyneurenine Aminotransferase I
  • kyneurenine aminotransferase
  • kyneurenine aminotransferase)
  • Kynurenine aminotransferase I
  • kynurenine--oxoglutarate transaminase 1
  • Kynurenine--oxoglutarate transaminase I

Background

This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01383
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1103
Species: Hu
Applications: WB, IHC, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-82862
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47761
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (H00000883-M02) (0)

There are no publications for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (H00000883-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (H00000883-M02) (0)

There are no reviews for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (H00000883-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (H00000883-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cysteine Conjugate beta-Lyase/CCBL1 Products

Bioinformatics Tool for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (H00000883-M02)

Discover related pathways, diseases and genes to Cysteine Conjugate beta-Lyase/CCBL1 Antibody (H00000883-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (H00000883-M02)

Discover more about diseases related to Cysteine Conjugate beta-Lyase/CCBL1 Antibody (H00000883-M02).
 

Pathways for Cysteine Conjugate beta-Lyase/CCBL1 Antibody (H00000883-M02)

View related products by pathway.

Blogs on Cysteine Conjugate beta-Lyase/CCBL1

There are no specific blogs for Cysteine Conjugate beta-Lyase/CCBL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cysteine Conjugate beta-Lyase/CCBL1 Antibody (1B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol CCBL1
Entrez
Uniprot