Recombinant Human CYP4V2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CYP4V2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 525 of Human CYP4V2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLKILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
CYP4V2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
87.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYP4V2 GST (N-Term) Protein

  • BCD
  • CYP4AH1
  • cytochrome P450 4V2
  • cytochrome P450, family 4, subfamily V, polypeptide 2
  • EC 1.14
  • EC 1.14.14.1
  • FLJ18432
  • MGC43534

Background

This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-44421
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NBP2-92924
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB120-13592
Species: Hu, Mu
Applications: WB
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF3880
Species: Hu
Applications: ICC, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP1-33202
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2460
Species: Hu
Applications: IP, Neut, WB
PP-H6506-00
Species: Hu
Applications: DirELISA, IP, WB
NBP2-56288
Species: Hu
Applications: ICC/IF, WB
NBP2-24503
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7550
Species: Hu
Applications: KO, WB

Publications for CYP4V2 Recombinant Protein (H00285440-P01) (0)

There are no publications for CYP4V2 Recombinant Protein (H00285440-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP4V2 Recombinant Protein (H00285440-P01) (0)

There are no reviews for CYP4V2 Recombinant Protein (H00285440-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP4V2 Recombinant Protein (H00285440-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP4V2 Products

Bioinformatics Tool for CYP4V2 Recombinant Protein (H00285440-P01)

Discover related pathways, diseases and genes to CYP4V2 Recombinant Protein (H00285440-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP4V2 Recombinant Protein (H00285440-P01)

Discover more about diseases related to CYP4V2 Recombinant Protein (H00285440-P01).
 

Pathways for CYP4V2 Recombinant Protein (H00285440-P01)

View related products by pathway.

PTMs for CYP4V2 Recombinant Protein (H00285440-P01)

Learn more about PTMs related to CYP4V2 Recombinant Protein (H00285440-P01).
 

Research Areas for CYP4V2 Recombinant Protein (H00285440-P01)

Find related products by research area.

Blogs on CYP4V2

There are no specific blogs for CYP4V2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYP4V2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP4V2