CYP4V2 Antibody

Images

 
Western Blot: CYP4V2 Antibody [NBP1-85361] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30
Immunohistochemistry-Paraffin: CYP4V2 Antibody [NBP1-85361] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP4V2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP4V2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CYP4V2 Protein (NBP1-85361PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYP4V2 Antibody

  • BCD
  • CYP4AH1
  • cytochrome P450 4V2
  • cytochrome P450, family 4, subfamily V, polypeptide 2
  • EC 1.14
  • EC 1.14.14.1
  • FLJ18432
  • MGC43534

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61614
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB120-13592
Species: Hu
Applications: WB
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-35006
Species: Hu
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-33202
Species: Hu, Mu
Applications: WB, IP
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
MAB24601
Species: Hu
Applications: WB, IP, Neut
PP-H6506-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-56288
Species: Hu
Applications: ICC/IF
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7550
Species: Hu
Applications: WB

Publications for CYP4V2 Antibody (NBP1-85361) (0)

There are no publications for CYP4V2 Antibody (NBP1-85361).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP4V2 Antibody (NBP1-85361) (0)

There are no reviews for CYP4V2 Antibody (NBP1-85361). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP4V2 Antibody (NBP1-85361) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP4V2 Products

Bioinformatics Tool for CYP4V2 Antibody (NBP1-85361)

Discover related pathways, diseases and genes to CYP4V2 Antibody (NBP1-85361). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP4V2 Antibody (NBP1-85361)

Discover more about diseases related to CYP4V2 Antibody (NBP1-85361).
 

Pathways for CYP4V2 Antibody (NBP1-85361)

View related products by pathway.

PTMs for CYP4V2 Antibody (NBP1-85361)

Learn more about PTMs related to CYP4V2 Antibody (NBP1-85361).

Blogs on CYP4V2

There are no specific blogs for CYP4V2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP4V2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP4V2