Cyclin D3 Antibody

Western Blot: Cyclin D3 Antibody [H00000896-D01P] - Analysis of CCND3 expression in Jurkat.

Western Blot: Cyclin D3 Antibody [H00000896-D01P] - Analysis of CCND3 expression in transfected 293T cell line by CCND3 polyclonal antibody.Lane 1: CCND3 transfected lysate(32.50 KDa).Lane 2: Non-transfected lysate.

Proximity Ligation Assay: Cyclin D3 Antibody [H00000896-D01P] - Analysis of protein-protein interactions between CCND3 and AREG. HeLa cells were stained with anti-CCND3 rabbit purified polyclonal 1:1200 and anti-AREG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Product Discontinued

Cyclin D3 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CCND3 (NP_001751.1, 1 a.a. - 292 a.a.) full-length human protein. MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
• Specificity: CCND3 - cyclin D3,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCND3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cyclin D3 Antibody

• CCND3
• Cyclin D3
• D3-type cyclin
• G1/S-specific cyclin D3
• G1/S-specific cyclin-D3

Background

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activtiy is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. The CDK4 activity associated with this cyclin was reported to be necessary for cell cycle progression through G2 phase into mitosis after UV radiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cyclin D3 Antibody (H00000896-D01P)(1)

Publication using H00000896-D01P

• Rangrez AY, Pott J, Kluge A et al. Myeloid leukemia factor-1 is a novel modulator of neonatal rat cardiomyocyte proliferation. Biochim Biophys Acta 2017-01-10 [PMID: 28087342]

Bioinformatics

• Gene Symbol: CCND3
• Entrez:
  • 896(Human)
• Uniprot:
  • NP_001751.1(Human)