![Western Blot: Cyclin D3 Antibody [H00000896-B01P] - Analysis of CCND3 expression in transfected 293T cell line by CCND3 polyclonal antibody. Lane 1: CCND3 transfected lysate(32.12 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Cyclin-D3-Antibody-Western-Blot-H00000896-B01P-img0006.jpg "Western Blot: Cyclin D3 Antibody [H00000896-B01P] - Analysis of CCND3 expression in transfected 293T cell line by CCND3 polyclonal antibody. Lane 1: CCND3 transfected lysate(32.12 KDa). Lane 2: Non-transfected lysate.")
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | CCND3 (NP_001751, 1 a.a. - 292 a.a.) full-length human protein. MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL |
| Specificity | This product is specific for Human CCND3 purified MaxPab mouse polyclonal antibody (B01P) [Gene ID: 896]. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CCND3 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cyclin D3 Antibody (H00000896-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Cyclin D3 Antibody [H00000896-B01P] - Analysis of purified antibody to CCND3 on HeLa cell. (antibody concentration 7 ug/ml)](http://images.novusbio.com/fullsize/Cyclin-D3-Antibody-Immunocytochemistry-Immunofluorescence-H00000896-B01P-img0004.jpg "Immunocytochemistry/Immunofluorescence: Cyclin D3 Antibody [H00000896-B01P] - Analysis of purified antibody to CCND3 on HeLa cell. (antibody concentration 7 ug/ml)")
![Immunohistochemistry-Paraffin: Cyclin D3 Antibody [H00000896-B01P] - Analysis of purified antibody to CCND3 on formalin-fixed paraffin-embedded human salivary gland. (antibody concentration 3 ug/ml)](http://images.novusbio.com/fullsize/Cyclin-D3-Antibody-Immunohistochemistry-Paraffin-H00000896-B01P-img0005.jpg "Immunohistochemistry-Paraffin: Cyclin D3 Antibody [H00000896-B01P] - Analysis of purified antibody to CCND3 on formalin-fixed paraffin-embedded human salivary gland. (antibody concentration 3 ug/ml)")
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Western_Blot_13865.jpg)
![Immunohistochemistry CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Immunohistochemistry_13917.jpg)