CYB561 Antibody

Images

 
Western Blot: CYB561 Antibody [NBP1-69701] - This Anti-CYB561 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYB561 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYB561(cytochrome b-561) The peptide sequence was selected from the middle region of CYB561. Peptide sequence LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYB561
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYB561 and was validated on Western blot.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYB561 Antibody

  • cytochrome b561
  • cytochrome b-561FRRS2
  • ferric-chelate reductase 2

Background

CYB561 is a senescene-associated protein in normal human oral keratinocytes. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB300-914
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NB300-913
Species: Hu, Mu
Applications: WB, IHC-P, PEP-ELISA
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for CYB561 Antibody (NBP1-69701) (0)

There are no publications for CYB561 Antibody (NBP1-69701).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYB561 Antibody (NBP1-69701) (0)

There are no reviews for CYB561 Antibody (NBP1-69701). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYB561 Antibody (NBP1-69701) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYB561 Products

Bioinformatics Tool for CYB561 Antibody (NBP1-69701)

Discover related pathways, diseases and genes to CYB561 Antibody (NBP1-69701). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYB561 Antibody (NBP1-69701)

Discover more about diseases related to CYB561 Antibody (NBP1-69701).
 

Pathways for CYB561 Antibody (NBP1-69701)

View related products by pathway.

Blogs on CYB561

There are no specific blogs for CYB561, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYB561 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYB561
Uniprot