We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CUZD1 Recombinant Protein Antigen

Images

 
There are currently no images for CUZD1 Recombinant Protein Antigen (NBP2-56339PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CUZD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CUZD1.

Source: E. coli

Amino Acid Sequence: SNGNNLQLKDPTCRPKLSNVVEFSVPLNGCGTIRKVEDQSITYTNIITFSASSTSEVITRQKQLQIIVKCEM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CUZD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56339.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CUZD1 Recombinant Protein Antigen

  • CUB and zona pellucida-like domain-containing protein 1
  • CUB and zona pellucida-like domains 1
  • CUB and ZP domain-containing protein 1
  • ERG-1
  • estrogen regulated gene 1
  • Transmembrane protein UO-44
  • UO-44

Background

CUZD1, also known as CUB and zona pellucida-like domain-containing protein 1, contains a 68 kDa, 37 kDa, and 27 kDa isoform, and is involved in preventing the attachment and proliferation of ovarian cancer cells, and may also affect the uterus during the final stages of pregnancy. Researchers are currently conducting experiments to determine the relationship between CUZD1 and diseases such as ovarian cancer and pancreatitis. The protein interacts with PTPN6, and is linked to cell migration, cell proliferation, and the hormone-mediated signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2818
Species: Hu
Applications: ICC, WB
NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-84125
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP3-03109
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-182
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
DANG20
Species: Hu
Applications: ELISA
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for CUZD1 Recombinant Protein Antigen (NBP2-56339PEP) (0)

There are no publications for CUZD1 Recombinant Protein Antigen (NBP2-56339PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CUZD1 Recombinant Protein Antigen (NBP2-56339PEP) (0)

There are no reviews for CUZD1 Recombinant Protein Antigen (NBP2-56339PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CUZD1 Recombinant Protein Antigen (NBP2-56339PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CUZD1 Products

Research Areas for CUZD1 Recombinant Protein Antigen (NBP2-56339PEP)

Find related products by research area.

Blogs on CUZD1

There are no specific blogs for CUZD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CUZD1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CUZD1