Recombinant Human CUGBP1/CELF1 GST (N-Term) Protein

SDS-Page: CUGBP1 Recombinant Protein [H00010658-P01]

Product Discontinued

Recombinant Human CUGBP1/CELF1 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-483 of Human CUGBP1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CELF1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CUGBP1/CELF1 GST (N-Term) Protein

• BRUNOL2
• BRUNOL250 kDa nuclear polyadenylated RNA-binding protein
• bruno-like 2
• Bruno-like protein 2
• CELF1
• CUG RNA-binding protein
• CUG triplet repeat, RNA binding protein 1
• CUG triplet repeat, RNA-binding protein 1
• CUG-BP- and ETR-3-like factor 1
• CUGBP Elav-like family member 1
• CUG-BP
• CUGBP, Elav-like family member 1
• CUGBP1
• CUG-BP1
• CUGBP1CUG triplet repeat RNA-binding protein 1
• CUGBPCELF-1
• D2Wsu101e
• Deadenylation factor CUG-BP
• EDEN-BP homolog
• EDEN-BP
• embryo deadenylation element binding protein
• Embryo deadenylation element-binding protein homolog
• HNAB50
• NAB50
• NAB50CUG-BP1
• NAPOR
• nuclear polyadenylated RNA-binding protein, 50-kD
• RNA-binding protein BRUNOL-2

Background

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for CUGBP1/CELF1 Full Length Recombinant Protein (H00010658-P01)(3)

Publications using H00010658-P01

• Safiya K, Matias M, Daniel J et al. Splice-switching of the insulin receptor pre-mRNA alleviates tumorigenic hallmarks in rhabdomyosarcoma. NPJ Precis Oncol. 2022-01-11 [PMID: 35017650]
• Saul MJ, Baumann I, Bruno A et al. miR-574-5p as RNA decoy for CUGBP1 stimulates human lung tumor growth by mPGES-1 induction. FASEB J. 2019-03-28 [PMID: 30922080]
• Yu TX, Rao JN, Zou T et al. Competitive Binding of CUGBP1 and HuR to Occludin mRNA Controls Its Translation and Modulates Epithelial Barrier Function. Mol Biol Cell. 2012-11-14 [PMID: 23155001]

Bioinformatics

• Gene Symbol: CELF1