CRHBP Antibody

Images

 
Western Blot: CRHBP Antibody [H00001393-D01P] - Analysis of CRHBP expression in human colon.
Western Blot: CRHBP Antibody [H00001393-D01P] - Analysis of CRHBP expression in transfected 293T cell line by CRHBP polyclonal antibody.Lane 1: CRHBP transfected lysate(36.10 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRHBP Antibody Summary

Immunogen
CRHBP (NP_001873.2, 1 a.a. - 322 a.a.) full-length human protein. MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
Specificity
Reacts with corticotropin releasing hormone binding protein.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRHBP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRHBP Antibody

  • corticotropin releasing hormone binding protein
  • corticotropin-releasing factor-binding protein
  • Corticotropin-releasing hormone-binding protein
  • CRFBP
  • CRFBPcorticotropin releasing hormone-binding protein
  • CRF-BPCRF-binding protein
  • CRHBP
  • CRH-BP

Background

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
9134-TN
Species: Hu
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-00175
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB7447
Species: Hu
Applications: WB, IHC
NB100-56485
Species: Hu, Mu, Rt, Bv, Ca, Ch
Applications: WB, Simple Western
7570-GH
Species: Hu
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-80732
Species: Hu
Applications: IHC, IHC-P

Publications for CRHBP Antibody (H00001393-D01P) (0)

There are no publications for CRHBP Antibody (H00001393-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRHBP Antibody (H00001393-D01P) (0)

There are no reviews for CRHBP Antibody (H00001393-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRHBP Antibody (H00001393-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRHBP Products

Bioinformatics Tool for CRHBP Antibody (H00001393-D01P)

Discover related pathways, diseases and genes to CRHBP Antibody (H00001393-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRHBP Antibody (H00001393-D01P)

Discover more about diseases related to CRHBP Antibody (H00001393-D01P).
 

Pathways for CRHBP Antibody (H00001393-D01P)

View related products by pathway.

PTMs for CRHBP Antibody (H00001393-D01P)

Learn more about PTMs related to CRHBP Antibody (H00001393-D01P).

Blogs on CRHBP

There are no specific blogs for CRHBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRHBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRHBP
Entrez
Uniprot