Recombinant Human CPNE7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CPNE7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 460-558 of Human CPNE7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ASRLPMSIIIVGVGNADFTDMQVLDGDDGVLRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEYYSHRGLPPRSLGVPAGEASPGCTP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CPNE7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CPNE7 Protein

  • copine 7
  • copine VIIMGC34192
  • copine-7

Background

CPNE7 - copine VII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85939
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-54980
Species: Hu
Applications: WB, ICC/IF
NBP1-87521
Species: Hu
Applications: WB, IHC, IHC-P
H00006263-R01
Species: Hu
AF1936
Species: Hu
Applications: WB, IP
NBP1-62667
Species: Hu
Applications: WB
NBP1-85548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-92581
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1305
Species: Hu
Applications: WB, Simple Western, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-22294
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-85305
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP2-14286
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for CPNE7 Partial Recombinant Protein (H00027132-Q01) (0)

There are no publications for CPNE7 Partial Recombinant Protein (H00027132-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPNE7 Partial Recombinant Protein (H00027132-Q01) (0)

There are no reviews for CPNE7 Partial Recombinant Protein (H00027132-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPNE7 Partial Recombinant Protein (H00027132-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPNE7 Products

Bioinformatics Tool for CPNE7 Partial Recombinant Protein (H00027132-Q01)

Discover related pathways, diseases and genes to CPNE7 Partial Recombinant Protein (H00027132-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPNE7 Partial Recombinant Protein (H00027132-Q01)

Discover more about diseases related to CPNE7 Partial Recombinant Protein (H00027132-Q01).
 

Pathways for CPNE7 Partial Recombinant Protein (H00027132-Q01)

View related products by pathway.

PTMs for CPNE7 Partial Recombinant Protein (H00027132-Q01)

Learn more about PTMs related to CPNE7 Partial Recombinant Protein (H00027132-Q01).

Blogs on CPNE7

There are no specific blogs for CPNE7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CPNE7 Antibody
NBP1-85827

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CPNE7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CPNE7