![Immunocytochemistry/Immunofluorescence: C7orf58 Antibody [NBP1-93947] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.](http://images.novusbio.com/fullsize2/C7orf58-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93947-img0006.jpg "Immunocytochemistry/Immunofluorescence: C7orf58 Antibody [NBP1-93947] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQCFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPGLLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CPED1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
 - BSA Free-Knockout Validated-NB300-164-img0009.jpg)
---BSA-Free-Immunohistochemistry-Paraffin-NB300-164-img0004.jpg)
---BSA-Free-Immunohistochemistry-Paraffin-NB300-164-img0005.jpg)
| Publication using NBP1-93947 | Applications | Species |
|---|---|---|
| Stadler C, Fagerberg L, Sivertsson A et al. RNA- and antibody-based profiling of the human proteome with focus on chromosome 19. J Proteome Res 2014-04-04 [PMID: 24579871] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CPED1 |
![Immunohistochemistry-Paraffin: C7orf58 Antibody [NBP1-93947] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/C7orf58-Antibody-Immunohistochemistry-Paraffin-NBP1-93947-img0002.jpg "Immunohistochemistry-Paraffin: C7orf58 Antibody [NBP1-93947] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Western Blot Parkin Antibody [Unconjugated]](https://images.novusbio.com/images2/Parkin_AF1438_Western_Blot_22174.jpg)
![Immunohistochemistry Parkin Antibody [Unconjugated]](https://images.novusbio.com/images2/Parkin_AF1438_Immunohistochemistry_6700.jpg)
-Western-Blot-NB100-159-img0002.jpg)
-Western-Blot-NB100-159-img0004.jpg)
-Immunohistochemistry-Paraffin-NB100-159-img0005.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")