CPED1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C7orf58 Antibody [NBP1-93947] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: C7orf58 Antibody [NBP1-93947] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPED1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQCFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPGLLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGL
Specificity
Specificity of human C7orf58 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPED1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using NBP1-93947.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24579871)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPED1 Antibody

  • C7orf58
  • cadherin-like and PC-esterase domain containing 1
  • chromosome 7 open reading frame 58
  • FLJ21986
  • FLJ26813

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Dual ISH-IHC
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
H00027130-P02
Species: Hu
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1438
Species: Hu
Applications: WB, IHC
NB100-159
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-87939
Species: Hu
Applications: IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-93947
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CPED1 Antibody (NBP1-93947)(1)

Reviews for CPED1 Antibody (NBP1-93947) (0)

There are no reviews for CPED1 Antibody (NBP1-93947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CPED1 Antibody (NBP1-93947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CPED1 Products

Array NBP1-93947

Bioinformatics Tool for CPED1 Antibody (NBP1-93947)

Discover related pathways, diseases and genes to CPED1 Antibody (NBP1-93947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CPED1

There are no specific blogs for CPED1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPED1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPED1
Novus 100% Guarantee