CPA5 Antibody - BSA Free

Western Blot: CPA5 Antibody [NBP2-82750] - WB Suggested Anti-Cpa5 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Muscle

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CPA5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CPA5 Antibody - BSA Free (NBP2-82750) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CPA5. Peptide sequence: PGLSPVDRRTLLFCNFILAVAWGQVNFTGDQVLRVLAKNEKQLSLLRDLE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CPA5 Antibody - BSA Free

• carboxypeptidase A5
• EC 3.4.17
• EC 3.4.17.1
• FLJ35969

Background

Carboxypeptidases have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Members of the A/B subfamily of carboxypeptidases, such as CPA5, contain an approximately 90-amino acid pro region that assists in the folding of the active carboxypeptidase domain. Cleavage of the pro region activates the enzyme (Wei et al., 2002 [PubMed 11836249]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPA5