Recombinant Human COX7B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COX7B Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-80 of Human COX7B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
COX7B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COX7B Protein

  • Cytochrome c oxidase polypeptide VIIb
  • cytochrome c oxidase subunit 7B, mitochondrial
  • cytochrome c oxidase subunit VIIb
  • cytochrome-c oxidase chain VIIb

Background

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22, respectively. COX7B( AAH18386, 1 a.a. - 81 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55171
Species: Hu
Applications: ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31112
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-45645
Species: Hu
Applications: WB, IHC, IF
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46865
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39115
Species: Hu, Mu, Rt, Po, Bv, Dr, I, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-53281
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00084701-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00001349-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for COX7B Recombinant Protein (H00001349-P01) (0)

There are no publications for COX7B Recombinant Protein (H00001349-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX7B Recombinant Protein (H00001349-P01) (0)

There are no reviews for COX7B Recombinant Protein (H00001349-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX7B Recombinant Protein (H00001349-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX7B Products

Bioinformatics Tool for COX7B Recombinant Protein (H00001349-P01)

Discover related pathways, diseases and genes to COX7B Recombinant Protein (H00001349-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX7B Recombinant Protein (H00001349-P01)

Discover more about diseases related to COX7B Recombinant Protein (H00001349-P01).
 

Pathways for COX7B Recombinant Protein (H00001349-P01)

View related products by pathway.

PTMs for COX7B Recombinant Protein (H00001349-P01)

Learn more about PTMs related to COX7B Recombinant Protein (H00001349-P01).

Blogs on COX7B

There are no specific blogs for COX7B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX7B Antibody
NBP2-31703

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COX7B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COX7B