Recombinant Human COX6B1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COX6B1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-86 of Human COX6B1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
COX6B1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COX6B1 Protein

  • COX VIb-1
  • COX6B
  • COXG
  • COXVIb1
  • cytochrome c oxidase subunit 6B1
  • Cytochrome c oxidase subunit VIb isoform 1
  • cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)
  • cytochrome c oxidase subunit Vib

Background

COX6B1 - cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-45645
Species: Hu
Applications: WB, IHC, IF
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-39115
Species: Hu, Mu, Rt, Po, Bv, Dr, I, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-98535
Species: Hu
Applications: WB
NBP2-46865
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13865
Species: Hu
Applications: IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31112
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89499
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31703
Species: Hu
Applications: IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-14694
Species: Hu
Applications: IHC, IHC-P
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001340-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for COX6B1 Partial Recombinant Protein (H00001340-Q01) (0)

There are no publications for COX6B1 Partial Recombinant Protein (H00001340-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX6B1 Partial Recombinant Protein (H00001340-Q01) (0)

There are no reviews for COX6B1 Partial Recombinant Protein (H00001340-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX6B1 Partial Recombinant Protein (H00001340-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX6B1 Products

Bioinformatics Tool for COX6B1 Partial Recombinant Protein (H00001340-Q01)

Discover related pathways, diseases and genes to COX6B1 Partial Recombinant Protein (H00001340-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX6B1 Partial Recombinant Protein (H00001340-Q01)

Discover more about diseases related to COX6B1 Partial Recombinant Protein (H00001340-Q01).
 

Pathways for COX6B1 Partial Recombinant Protein (H00001340-Q01)

View related products by pathway.

PTMs for COX6B1 Partial Recombinant Protein (H00001340-Q01)

Learn more about PTMs related to COX6B1 Partial Recombinant Protein (H00001340-Q01).

Blogs on COX6B1

There are no specific blogs for COX6B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX6B1 Antibody
NBP1-85497

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COX6B1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COX6B1