Home » Corin » Corin Peptides and Proteins » Corin Recombinant Protein Antigen

Corin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Corin Recombinant Protein Antigen (NBP2-57979PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Corin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Corin.

Source: E.coli

Amino Acid Sequence: NVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQ
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CORIN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-57979 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Corin Recombinant Protein Antigen

  • ATC2
  • atrial natriuteric peptide-converting enzyme
  • Corin
  • corin, serine peptidase
  • EC 3.4.21
  • EC 3.4.21.-
  • heart specific serine proteinase
  • Heart-specific serine proteinase ATC2
  • MGC119742
  • pro-ANP-convertase
  • Pro-ANP-Converting Enzyme
  • PRSC
  • serine protease
  • Transmembrane protease serine 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

preproANP Antibody
NBP2-14873
Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-14873] - Paraffin-embedded mouse muscle. preproANP antibody diluted at 1:500.
Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-14873] - Mouse heart. ANP stained by preproANP antibody diluted at 1:500.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-14873] - Mouse heart. preproANP stained by preproANP antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Agrin
[Unconjugated]
550-AG/CF
Agrin [Unconjugated]
(17 Publications)
Species: Rt
Applications: BA, BA
EBPL Antibody
NBP2-13943
Immunohistochemistry-Paraffin: EBPL Antibody [NBP2-13943] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunocytochemistry/Immunofluorescence: EBPL Antibody [NBP2-13943] - Immunofluorescent staining of human cell line PC-3 shows localization to endoplasmic reticulum.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ELK3 Antibody
(OTI1H3)
NBP2-01264
Western Blot: ELK3 Antibody (OTI1H3) [NBP2-01264] - Breast cancer cells. Lane 1: MDA-MB231 + Negative control siRNA. Lane 2: MDA-MB231 + siELK3-1. Lane 3: MDA-MB231 + siELK3-2. Image from verified customer review.
Flow Cytometry: ELK3 Antibody (1H3) [NBP2-01264] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-ELK3 antibody, and then analyzed by flow cytometry.
Western Blot: ELK3 Antibody (1H3) [NBP2-01264] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ELK3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ELK3.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NT-proBNP Antibody
(OTI11G4)
NBP2-46201
Western Blot: NT-proBNP Antibody (OTI11G4) [NBP2-46201] - Analysis of HEK293T cells that were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY BNP.
Immunohistochemistry: NT-proBNP Antibody (OTI11G4) [NBP2-46201] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: NT-proBNP Antibody (OTI11G4) [NBP2-46201] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
LDLR Antibody (C7)
NBP1-78159
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Antibody was tested in HepG2 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - Analysis of an FFPE tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
(1 Review)
(20 Publications)
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
CD55/DAF was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using 15 µg/mL Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CD55/DAF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line (left panel, positive staining) and MOLT-4 human acute lymphoblastic leukemia cell line (right panel, negative staining) using Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) at 0.5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Publications)
Species: Hu
Applications: ICC, IHC
DHRS4 Antibody
NBP2-98675
Immunoprecipitation: DHRS4 Antibody [NBP2-98675] - DHRS4 was immunoprecipitated using: Lane A: 0.5 mg A549 Whole Cell Lysate 4 ul anti-DHRS4 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein A/G. Primary antibody: Anti-DHRS4 rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 30 kDa. Observed band size: 30 kDa
Western Blot: DHRS4 Antibody [NBP2-98675] - Anti-DHRS4 rabbit polyclonal antibody at 1:500 dilution. Lane A: Hela Whole Cell Lysate Lane B: A549 Whole Cell Lysate Lane C: MCF7 Whole Cell Lysate Lane D: U-251 MG Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 30 kDa. Observed band size: 30 kDa
Immunohistochemistry-Paraffin: DHRS4 Antibody [NBP2-98675] - Immunochemical staining of human DHRS4 in human kidney with rabbit polyclonal antibody at 1:100 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: IHC, IHC-P, IP, WB
CRIPTO Antibody -
BSA Free
NB100-1598
Flow Cytometry: CRIPTO Antibody [NB100-1598] - An intracellular stain was performed on HeLa cells with NB100-1598PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin
Flow Cytometry: CRIPTO Antibody [NB100-1598] - An intracellular stain was performed on Jurkat with NB100-1598 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Western Blot: CRIPTO Antibody [NB100-1598] - Total protein from human HeLa, NTERA-2 and spleen and embryonic mouse V6.5 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-Cripto in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
(3 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
SOST/Sclerostin
Antibody [Unconjugate
AF1589
SOST/Sclerostin was detected in immersion fixed frozen sections of mouse embryo (adrenal gland) using Goat Anti-Mouse SOST/Sclerostin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1589) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
SOST/Sclerostin was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using Goat Anti-Mouse SOST/Sclerostin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1589) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of human bone marrow and mouse bone marrow. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse SOST/Sclerostin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1589) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SOST/Sclerostin at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Reviews)
(55 Publications)
Species: Mu
Applications: IHC, WB
Calretinin Antibody
NBP1-88220
Immunocytochemistry/Immunofluorescence: Calretinin Antibody [NBP1-88220] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in cells in granular layer.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
CD21 Antibody
(SC0681)
NBP2-67605
Immunocytochemistry/Immunofluorescence: CD21 Antibody (SC0681) [NBP2-67605] - Staining CD21 in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: CD21 Antibody (SC0681) [NBP2-67605] - Staining CD21 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: CD21 Antibody (SC0681) [NBP2-67605] - Analysis of paraffin-embedded human gastric cancer tissue using anti-CD21 antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
LRP-5 Antibody
AF6646
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Human LRP-5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6646) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for LRP-5 at approximately 185 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu
Applications: WB
Hepsin
4776-SE
Hepsin
(3 Reviews)
(5 Publications)
Species: Hu
Applications: EnzAct
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(8 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB

Publications for Corin Recombinant Protein Antigen (NBP2-57979PEP) (0)

There are no publications for Corin Recombinant Protein Antigen (NBP2-57979PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Corin Recombinant Protein Antigen (NBP2-57979PEP) (0)

There are no reviews for Corin Recombinant Protein Antigen (NBP2-57979PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Corin Recombinant Protein Antigen (NBP2-57979PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Corin Products

Bioinformatics Tool for Corin Recombinant Protein Antigen (NBP2-57979PEP)

Discover related pathways, diseases and genes to Corin Recombinant Protein Antigen (NBP2-57979PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Corin Recombinant Protein Antigen (NBP2-57979PEP)

Discover more about diseases related to Corin Recombinant Protein Antigen (NBP2-57979PEP).
 

Pathways for Corin Recombinant Protein Antigen (NBP2-57979PEP)

View related products by pathway.

PTMs for Corin Recombinant Protein Antigen (NBP2-57979PEP)

Learn more about PTMs related to Corin Recombinant Protein Antigen (NBP2-57979PEP).

Blogs on Corin

There are no specific blogs for Corin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SOST/Sclerostin was detected in immersion fixed frozen sections of mouse embryo (adrenal gland) using Goat Anti-Mouse SOST/Sclerostin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1589) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
SOST/Sclerostin Antibody [Unconjugated]
AF1589
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Antibody was tested in HepG2 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
LDLR Antibody (C7)
NBP1-78159

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Corin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CORIN