Corin Antibody

Immunocytochemistry/Immunofluorescence: Corin Antibody [NBP2-57979] - Staining of human cell line U-2 OS shows localization to plasma membrane & actin filaments.

Product Discontinued

Corin Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CORIN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Corin Antibody

• ATC2
• atrial natriuteric peptide-converting enzyme
• Corin
• corin, serine peptidase
• EC 3.4.21
• EC 3.4.21.-
• heart specific serine proteinase
• Heart-specific serine proteinase ATC2
• MGC119742
• pro-ANP-convertase
• Pro-ANP-Converting Enzyme
• PRSC
• serine protease
• Transmembrane protease serine 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CORIN