COQ3 Antibody (6D5)

Images

 
Western Blot: COQ3 Antibody (6D5) [H00051805-M01] - Analysis of COQ3 expression in transfected 293T cell line by COQ3 monoclonal antibody (M01), clone 6D5.Lane 1: COQ3 transfected lysate(41 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COQ3 Antibody (6D5) Summary

Immunogen
COQ3 (NP_059117, 273 a.a. ~ 370 a.a) partial recombinant protein with GST tag.IVPKGTHTWEKFVSPETLESILESNGLSVQTVVGMLYNPFSG YWHWSENTSLNYAAHAVKSRVQEHPASAEFVLKGETEELQAN ACTNPAVHEKLKK
Localization
Mitochondrion matrix.
Specificity
COQ3 - coenzyme Q3 homolog, methyltransferase (yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
COQ3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COQ3 Antibody (6D5)

  • 3-demethylubiquinone-10 3-methyltransferase
  • bA9819.1
  • coenzyme Q3 homolog, methyltransferase (S. cerevisiae)
  • coenzyme Q3 homolog, methyltransferase (yeast)
  • DHHB methyltransferase
  • DHHBMT
  • DHHB-MT
  • DHHBMTASE
  • DHHB-MTase
  • Dihydroxyhexaprenylbenzoate methyltransferase
  • EC 2.1.1
  • EC 2.1.1.114
  • EC 2.1.1.64
  • hexaprenyldihydroxybenzoate methyltransferase, mitochondrial3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase
  • methyltransferase COQ3
  • UG0215E05

Background

Ubiquinone, also known as coenzyme Q, or Q, is a critical component of the electron transport pathways of both eukaryotes and prokaryotes (Jonassen and Clarke, 2000 [PubMed 10777520]). This lipid consists of a hydrophobic isoprenoid tail and a quinone head group. The tail varies in length depending on the organism, but its purpose is to anchor coenzyme Q to the membrane. The quinone head group is responsible for the activity of coenzyme Q in the respiratory chain. The S. cerevisiae COQ3 gene encodes an O-methyltransferase required for 2 steps in the biosynthetic pathway of coenzyme Q. This enzyme methylates an early coenzyme Q intermediate, 3,4-dihydroxy-5-polyprenylbenzoic acid, as well as the final intermediate in the pathway, converting demethyl-ubiquinone to coenzyme Q. The COQ3 gene product is also capable of methylating the distinct prokaryotic early intermediate 2-hydroxy-6-polyprenyl phenol.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91806
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39084
Species: Hu
Applications: IHC, IHC-P
NBP2-13860
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13859
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55409
Species: Hu
Applications: WB, ICC/IF
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-495
Species: Hu
Applications: WB
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15659
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00010434-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051805-M01
Species: Hu
Applications: WB, ELISA

Publications for COQ3 Antibody (H00051805-M01) (0)

There are no publications for COQ3 Antibody (H00051805-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COQ3 Antibody (H00051805-M01) (0)

There are no reviews for COQ3 Antibody (H00051805-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COQ3 Antibody (H00051805-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COQ3 Products

Bioinformatics Tool for COQ3 Antibody (H00051805-M01)

Discover related pathways, diseases and genes to COQ3 Antibody (H00051805-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COQ3 Antibody (H00051805-M01)

Discover more about diseases related to COQ3 Antibody (H00051805-M01).
 

Pathways for COQ3 Antibody (H00051805-M01)

View related products by pathway.

PTMs for COQ3 Antibody (H00051805-M01)

Learn more about PTMs related to COQ3 Antibody (H00051805-M01).
 

Research Areas for COQ3 Antibody (H00051805-M01)

Find related products by research area.

Blogs on COQ3

There are no specific blogs for COQ3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COQ3 Antibody (6D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol COQ3
Entrez
OMIM
Uniprot