Connexin 32/GJB1 Antibody (2B9)

Images

 
Sandwich ELISA: Connexin 32/GJB1 Antibody (2B9) [H00002705-M03] - Detection limit for recombinant GST tagged GJB1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Connexin 32/GJB1 Antibody (2B9) Summary

Immunogen
GJB1 (AAH22426 75 a.a. - 174 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCP
Specificity
GJB1 - gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked) (2B9)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GJB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Connexin 32/GJB1 Antibody (2B9)

  • CMTX
  • CMTX1
  • Connexin 32
  • Connexin-32
  • CX32
  • CX32beta 1, 32kD (connexin 32, Charcot-Marie-Toothneuropathy, X-linked)
  • gap junction beta-1 protein
  • gap junction protein, beta 1, 32kDa (connexin 32)
  • gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Toothneuropathy, X-linked)
  • gap junction protein, beta 1, 32kDa
  • GJB1

Background

This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15012
Species: Hu
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NBP1-59254
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-88040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59263
Species: Hu
Applications: WB, IHC
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00002707-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-58660
Species: Hu
Applications: IHC-P
H00002705-M03
Species: Hu
Applications: ELISA

Publications for Connexin 32/GJB1 Antibody (H00002705-M03) (0)

There are no publications for Connexin 32/GJB1 Antibody (H00002705-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 32/GJB1 Antibody (H00002705-M03) (0)

There are no reviews for Connexin 32/GJB1 Antibody (H00002705-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Connexin 32/GJB1 Antibody (H00002705-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Connexin 32/GJB1 Products

Bioinformatics Tool for Connexin 32/GJB1 Antibody (H00002705-M03)

Discover related pathways, diseases and genes to Connexin 32/GJB1 Antibody (H00002705-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 32/GJB1 Antibody (H00002705-M03)

Discover more about diseases related to Connexin 32/GJB1 Antibody (H00002705-M03).
 

Pathways for Connexin 32/GJB1 Antibody (H00002705-M03)

View related products by pathway.

PTMs for Connexin 32/GJB1 Antibody (H00002705-M03)

Learn more about PTMs related to Connexin 32/GJB1 Antibody (H00002705-M03).

Blogs on Connexin 32/GJB1

There are no specific blogs for Connexin 32/GJB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Connexin 32/GJB1 Antibody (2B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol GJB1
Entrez
Uniprot