Connexin 26/GJB2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human Connexin 26/GJB2. Peptide sequence: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GJB2 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for Connexin 26/GJB2 Antibody - BSA Free
Background
Connexin-26 / GJB2 is a gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexins, through which materials of low molecular weight diffuse from one cell to a neighboring cell. Each connexin is composed of a hexamer of connexin proteins. Connexins are a multi-gene family of highly related proteins. At least a dozen distinct connexin genes have been identified and many are expressed in a tissue-specific manner. Two distinct lineages, class I (beta) and class II (alpha), have been identified in mammals. Connexin-26 belongs to the class 1 (beta) group of connexins. Mutations in Connexin-26 are associated with genetically derived hearing impairments, including autosomal recessive non syndromic deafness.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Publications for Connexin 26/GJB2 Antibody (NBP2-88789) (0)
There are no publications for Connexin 26/GJB2 Antibody (NBP2-88789).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Connexin 26/GJB2 Antibody (NBP2-88789) (0)
There are no reviews for Connexin 26/GJB2 Antibody (NBP2-88789).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Connexin 26/GJB2 Antibody (NBP2-88789) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Connexin 26/GJB2 Products
Research Areas for Connexin 26/GJB2 Antibody (NBP2-88789)
Find related products by research area.
|
Blogs on Connexin 26/GJB2