Connexin 26/GJB2 Antibody - BSA Free

Western Blot: Connexin 26/GJB2 Antibody [NBP2-88789] - WB Suggested Anti-GJB2 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:62500. Positive Control: Human Lung

Western Blot: Connexin 26/GJB2 Antibody [NBP2-88789] - WB Suggested Anti-GJB2 Antibody. Positive Control: Lane 1: 4ug mCx26 elution fraction 6 Lane 2: 4ug mCx26 elution fraction 7Lane 3: 4ug mCx26 elution fraction 6 + other Cx26 antibody Lane 4: 4ug mCx26 elution fraction 7 + other Cx26 antibody. Primary A

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Connexin 26/GJB2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Connexin 26/GJB2 Antibody - BSA Free (NBP2-88789) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human Connexin 26/GJB2. Peptide sequence: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GJB2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Connexin 26/GJB2 Antibody - BSA Free

• beta 2, 26kD (connexin 26)
• Connexin 26
• CX26
• CX26DFNA3
• DFNA3
• DFNA3A
• DFNB1
• gap junction protein, beta 2, 26kDa (connexin 26)
• gap junction protein, beta 2, 26kDa
• GJB2
• HID
• KID
• NSRD1
• PPK

Background

Connexin-26 / GJB2 is a gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexins, through which materials of low molecular weight diffuse from one cell to a neighboring cell. Each connexin is composed of a hexamer of connexin proteins. Connexins are a multi-gene family of highly related proteins. At least a dozen distinct connexin genes have been identified and many are expressed in a tissue-specific manner. Two distinct lineages, class I (beta) and class II (alpha), have been identified in mammals. Connexin-26 belongs to the class 1 (beta) group of connexins. Mutations in Connexin-26 are associated with genetically derived hearing impairments, including autosomal recessive non syndromic deafness.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GJB2