Recombinant Human COG8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COG8 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 450-545 of Human COG8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNI

Protein/Peptide Type
Partial Recombinant Protein
Gene
COG8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COG8 Protein

  • COG complex subunit 8
  • component of oligomeric golgi complex 8CDG2H
  • conserved oligomeric Golgi complex subunit 8
  • dependent on RIC1
  • DOR1conserved oligomeric golgi complex component 8
  • FLJ22315

Background

This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1618
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81414
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57681
Species: Hu
Applications: WB, ICC/IF
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47502
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-93713
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00814
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu

Publications for COG8 Partial Recombinant Protein (H00084342-Q01) (0)

There are no publications for COG8 Partial Recombinant Protein (H00084342-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG8 Partial Recombinant Protein (H00084342-Q01) (0)

There are no reviews for COG8 Partial Recombinant Protein (H00084342-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COG8 Partial Recombinant Protein (H00084342-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COG8 Products

Bioinformatics Tool for COG8 Partial Recombinant Protein (H00084342-Q01)

Discover related pathways, diseases and genes to COG8 Partial Recombinant Protein (H00084342-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COG8 Partial Recombinant Protein (H00084342-Q01)

Discover more about diseases related to COG8 Partial Recombinant Protein (H00084342-Q01).
 

Pathways for COG8 Partial Recombinant Protein (H00084342-Q01)

View related products by pathway.

PTMs for COG8 Partial Recombinant Protein (H00084342-Q01)

Learn more about PTMs related to COG8 Partial Recombinant Protein (H00084342-Q01).

Blogs on COG8

There are no specific blogs for COG8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POMC Antibody
NB100-1533
COG8 Antibody
NBP2-58437
MDH2 Antibody
NBP1-32259

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COG8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COG8