CMTM4 Antibody - BSA Free

Immunohistochemistry-Paraffin: CMTM4 Antibody [NBP1-84457] - Analysis in human thyroid gland and liver tissues using NBP1-84457 antibody. Corresponding CMTM4 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: CMTM4 Antibody [NBP1-84457] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CMTM4 Antibody [NBP1-84457] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CMTM4 Antibody [NBP1-84457] - Staining of human cerebral cortex shows strong positivity in neuropil.

Immunohistochemistry-Paraffin: CMTM4 Antibody [NBP1-84457] - Staining of human liver shows low expression in hepatocytes as expected.

Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CMTM4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CMTM4 Antibody - BSA Free (NBP1-84457) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-CMTM4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CMTM4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CMTM4 Protein (NBP1-84457PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CMTM4 Antibody - BSA Free

• chemokine-like factor super family 4
• chemokine-like factor superfamily 4
• Chemokine-like factor superfamily member 4
• CKLF-like MARVEL transmembrane domain containing 4
• CKLF-like MARVEL transmembrane domain-containing protein 4
• CKLFSF4
• CMTM4

Background

CMTM4 belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CMTM4 Antibody (NBP1-84457)(2)

Publications using NBP1-84457

• Zhu X, Zhang S, Tan S et al. Expression of CMTM4 shows clinical significance in lung cancer Translational Cancer Research 2020-10-01 [PMID: 35117232] (Immunohistochemistry-Paraffin, Human)
• Bei C, Zhang Y, Wei R et al. Clinical significance of CMTM4 expression in hepatocellular carcinoma Onco Targets Ther. 2017-11-14 [PMID: 29180877] (IHC-P, Human)

Bioinformatics

• Gene Symbol: CMTM4