CMTM4 Antibody

Images

 
Western Blot: CMTM4 Antibody [NBP1-84457] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: CMTM4 Antibody [NBP1-84457] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: CMTM4 Antibody [NBP1-84457] - Staining of human pancreas shows strong cytoplasmic and membranous positivity in islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CMTM4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CMTM4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CMTM4 Protein (NBP1-84457PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CMTM4 Antibody

  • chemokine-like factor super family 4
  • chemokine-like factor superfamily 4
  • Chemokine-like factor superfamily member 4
  • CKLF-like MARVEL transmembrane domain containing 4
  • CKLF-like MARVEL transmembrane domain-containing protein 4
  • CKLFSF4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56745
Species: Hu
Applications: ICC/IF
H00123920-T01
Species: Hu
NBP2-57873
Species: Hu
Applications: ICC/IF
NBP2-47503
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31183
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59439
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00001446-D01P
Species: Hu, Mu
Applications: WB
NBP2-31594
Species: Hu
Applications: IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC

Publications for CMTM4 Antibody (NBP1-84457) (0)

There are no publications for CMTM4 Antibody (NBP1-84457).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMTM4 Antibody (NBP1-84457) (0)

There are no reviews for CMTM4 Antibody (NBP1-84457). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CMTM4 Antibody (NBP1-84457) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CMTM4 Products

Bioinformatics Tool for CMTM4 Antibody (NBP1-84457)

Discover related pathways, diseases and genes to CMTM4 Antibody (NBP1-84457). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CMTM4 Antibody (NBP1-84457)

Discover more about diseases related to CMTM4 Antibody (NBP1-84457).
 

Pathways for CMTM4 Antibody (NBP1-84457)

View related products by pathway.

PTMs for CMTM4 Antibody (NBP1-84457)

Learn more about PTMs related to CMTM4 Antibody (NBP1-84457).
 

Research Areas for CMTM4 Antibody (NBP1-84457)

Find related products by research area.

Blogs on CMTM4

There are no specific blogs for CMTM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CMTM4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CMTM4