CMC1 Recombinant Protein Antigen

Images

 
There are currently no images for CMC1 Protein (NBP1-86786PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CMC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CMC1.

Source: E.coli

Amino Acid Sequence: RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CMC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-86786.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CMC1 Recombinant Protein Antigen

  • C3orf68
  • chromosome 3 open reading frame 68
  • cmc1p
  • COX assembly mitochondrial protein homolog (S. cerevisiae)
  • COX assembly mitochondrial protein homolog
  • CX9C mitochondrial protein required for full expression of COX 1
  • DKFZp779D0833
  • MGC61571
  • mitochondrial metallochaperone-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77022
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
35940002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-42664
Species: Hu
Applications: WB, IHC, IP
H00001831-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001351-P01
Species: Hu
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-27541
Species: Mu
Applications: WB, PEP-ELISA
6507-IL/CF
Species: Hu
NBP2-37510
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
7584-SF/CF
Species: Hu
NBP1-93450
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF5094
Species: Hu, Mu, Rt
Applications: WB

Publications for CMC1 Protein (NBP1-86786PEP) (0)

There are no publications for CMC1 Protein (NBP1-86786PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMC1 Protein (NBP1-86786PEP) (0)

There are no reviews for CMC1 Protein (NBP1-86786PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CMC1 Protein (NBP1-86786PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional CMC1 Products

Bioinformatics Tool for CMC1 Protein (NBP1-86786PEP)

Discover related pathways, diseases and genes to CMC1 Protein (NBP1-86786PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CMC1 Protein (NBP1-86786PEP)

Discover more about diseases related to CMC1 Protein (NBP1-86786PEP).
 

Pathways for CMC1 Protein (NBP1-86786PEP)

View related products by pathway.

PTMs for CMC1 Protein (NBP1-86786PEP)

Learn more about PTMs related to CMC1 Protein (NBP1-86786PEP).

Blogs on CMC1

There are no specific blogs for CMC1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CMC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CMC1