CLPS Antibody (4G3)

Images

 
Western Blot: CLPS Antibody (4G3) [H00001208-M05] - Analysis of CLPS expression in transfected 293T cell line by CLPS monoclonal antibody (M05), clone 4G3. Lane 1: CLPS transfected lysate (Predicted MW: 12 KDa). Lane 2: ...read more
ELISA: CLPS Antibody (4G3) [H00001208-M05] - Detection limit for recombinant GST tagged CLPS is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CLPS Antibody (4G3) Summary

Immunogen
CLPS (NP_001823, 23 a.a. - 112 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ
Specificity
CLPS - colipase, pancreatic (4G3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLPS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLPS Antibody (4G3)

  • colipase
  • colipase, pancreatic
  • pancreatic colipase preproprotein

Background

The protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005408-D01P
Species: Hu, Mu
Applications: WB
NBP1-89557
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7105
Species: Hu
Applications: WB
MAB5018
Species: Hu
Applications: WB, IP
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB110-60930
Species: Hu, Mu
Applications: WB
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-48988
Species: Hu
Applications: IHC
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for CLPS Antibody (H00001208-M05) (0)

There are no publications for CLPS Antibody (H00001208-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLPS Antibody (H00001208-M05) (0)

There are no reviews for CLPS Antibody (H00001208-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLPS Antibody (H00001208-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLPS Products

Bioinformatics Tool for CLPS Antibody (H00001208-M05)

Discover related pathways, diseases and genes to CLPS Antibody (H00001208-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLPS Antibody (H00001208-M05)

Discover more about diseases related to CLPS Antibody (H00001208-M05).
 

Pathways for CLPS Antibody (H00001208-M05)

View related products by pathway.

PTMs for CLPS Antibody (H00001208-M05)

Learn more about PTMs related to CLPS Antibody (H00001208-M05).
 

Research Areas for CLPS Antibody (H00001208-M05)

Find related products by research area.

Blogs on CLPS

There are no specific blogs for CLPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLPS Antibody (4G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLPS
Entrez
Uniprot