CLEC10A/CD301 Antibody - BSA Free

Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human testis shows mocerate to strong cytoplasmic postivity in Leydig cells.

Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human lymph node shows moderate to strong membranous positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human small intestine shows moderate to strong membranous positivity in lymphoid cells.

Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Analysis in control (vector only transfected HEK293T lysate) and CLEC10A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405320).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLEC10A/CD301 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CLEC10A/CD301 Antibody - BSA Free (NBP1-84591) is a polyclonal antibody validated for use in IHC and WB. Anti-CLEC10A/CD301 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWND
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLEC10A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CLEC10A/CD301 Protein (NBP1-84591PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CLEC10A/CD301 Antibody - BSA Free

• CD301 antigen
• CD301
• CD301C-type lectin domain family 10 member A
• CLEC10A
• CLECSF13
• CLECSF14
• CLECSF14macrophage C-type lectin
• C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 14 (macrophage-derived)
• C-type lectin domain family 10, member A
• C-type lectin superfamily member 14
• HML2
• HMLC-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 13 (macrophage-derived)
• macrophage lectin 2 (calcium dependent)
• Macrophage lectin 2
• MGL

Background

CD301 encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CLEC10A/CD301 Antibody (NBP1-84591)(1)

Publication using NBP1-84591

• Yao S, Zhou Z, Wang L et al. Targeting endometrial inflammation in intrauterine adhesion ameliorates endometrial fibrosis by priming MSCs to secrete C1INH iScience 2023-06-01 [PMID: 37456855]

Bioinformatics

• Gene Symbol: CLEC10A
• Entrez:
  • 10462(Human)
• Uniprot:
  • Q8IUN9(Human)