CLEC10A/CD301 Antibody

Images

 
Western Blot: CLEC10A/CD301 Antibody [NBP1-84591] - Analysis in control (vector only transfected HEK293T lysate) and CLEC10A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human small intestine shows strong positivity in subsets of lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLEC10A/CD301 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWND
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLEC10A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLEC10A/CD301 Protein (NBP1-84591PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLEC10A/CD301 Antibody

  • CD301 antigen
  • CD301
  • CD301C-type lectin domain family 10 member A
  • CLEC10A
  • CLECSF13
  • CLECSF14
  • CLECSF14macrophage C-type lectin
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 14 (macrophage-derived)
  • C-type lectin domain family 10, member A
  • C-type lectin superfamily member 14
  • HML2
  • HMLC-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 13 (macrophage-derived)
  • macrophage lectin 2 (calcium dependent)
  • Macrophage lectin 2
  • MGL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBL1-11569
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu

Publications for CLEC10A/CD301 Antibody (NBP1-84591) (0)

There are no publications for CLEC10A/CD301 Antibody (NBP1-84591).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLEC10A/CD301 Antibody (NBP1-84591) (0)

There are no reviews for CLEC10A/CD301 Antibody (NBP1-84591). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLEC10A/CD301 Antibody (NBP1-84591) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLEC10A/CD301 Products

Bioinformatics Tool for CLEC10A/CD301 Antibody (NBP1-84591)

Discover related pathways, diseases and genes to CLEC10A/CD301 Antibody (NBP1-84591). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLEC10A/CD301 Antibody (NBP1-84591)

Discover more about diseases related to CLEC10A/CD301 Antibody (NBP1-84591).
 

Pathways for CLEC10A/CD301 Antibody (NBP1-84591)

View related products by pathway.

Blogs on CLEC10A/CD301

There are no specific blogs for CLEC10A/CD301, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLEC10A/CD301 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC10A
Entrez
Uniprot