Recombinant Human Claudin-16 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Claudin-16 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-305 of Human CLDN16

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVAGATLLIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CLDN16
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
60.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Claudin-16 GST (N-Term) Protein

  • claudin 16
  • Claudin16
  • Claudin-16
  • CLDN16
  • HOMG3
  • HOMG3paracellin-1
  • Paracellin-1
  • PCLN1
  • PCLN-1
  • PCLN1hypomagnesemia 3, with hypercalciuria and nephrocalcinosis

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00149461-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP1-82016
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88109
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-18555
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB7665
Species: Hu
Applications: IHC, WB
NB120-19347
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, KD, WB
NB100-93520
Species: Hu
Applications: PEP-ELISA, WB
NBP2-92405
Species: Hu, Mu, Rt
Applications: WB
NBP2-12906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP1-44270
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, WB

Publications for Claudin-16 Full Length Recombinant Protein (H00010686-P01) (0)

There are no publications for Claudin-16 Full Length Recombinant Protein (H00010686-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-16 Full Length Recombinant Protein (H00010686-P01) (0)

There are no reviews for Claudin-16 Full Length Recombinant Protein (H00010686-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-16 Full Length Recombinant Protein (H00010686-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Claudin-16 Products

Research Areas for Claudin-16 Full Length Recombinant Protein (H00010686-P01)

Find related products by research area.

Blogs on Claudin-16

There are no specific blogs for Claudin-16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Claudin-16 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN16