Recombinant Human Claudin-16 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Claudin-16 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 26665 of Human CLDN16 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRD

Protein/Peptide Type
Partial Recombinant Protein
Gene
CLDN16

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Claudin-16 Protein

  • claudin 16
  • Claudin16
  • Claudin-16
  • CLDN16
  • HOMG3
  • HOMG3paracellin-1
  • Paracellin-1
  • PCLN1
  • PCLN-1
  • PCLN1hypomagnesemia 3, with hypercalciuria and nephrocalcinosis

Background

CLDN16 - claudin 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00149461-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
H00140803-R03
Species: Hu
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-35213
Species: Hu
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NB100-810
Species: Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4279
Species: Hu
Applications: Flow, CyTOF-ready
H00010686-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Claudin-16 Partial Recombinant Protein (H00010686-Q01) (0)

There are no publications for Claudin-16 Partial Recombinant Protein (H00010686-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-16 Partial Recombinant Protein (H00010686-Q01) (0)

There are no reviews for Claudin-16 Partial Recombinant Protein (H00010686-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-16 Partial Recombinant Protein (H00010686-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Claudin-16 Products

Bioinformatics Tool for Claudin-16 Partial Recombinant Protein (H00010686-Q01)

Discover related pathways, diseases and genes to Claudin-16 Partial Recombinant Protein (H00010686-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-16 Partial Recombinant Protein (H00010686-Q01)

Discover more about diseases related to Claudin-16 Partial Recombinant Protein (H00010686-Q01).
 

Pathways for Claudin-16 Partial Recombinant Protein (H00010686-Q01)

View related products by pathway.

Blogs on Claudin-16

There are no specific blogs for Claudin-16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Claudin-16 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN16
Entrez