CIB2 Antibody

Western Blot: CIB2 Antibody [H00010518-A01] - Detection against Immunogen (37 KDa) .

Chromatin Immunoprecipitation: CIB2 Antibody [H00010518-A01] - Analysis of CIB2 in 5dpf zebrafish retina using anti-CIB2 antibody (red) and DAPI (blue). Image from verified customer review.

• Reactivity: Hu, Ze
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated

CIB2 Antibody Summary

• Immunogen: CIB2 (NP_006374, 1 a.a. - 99 a.a.) partial recombinant protein with GST tag. MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLC
• Specificity: CIB2 - calcium and integrin binding family member 2
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CIB2
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50% Glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CIB2 Antibody

• 2810434I23Rik
• calcium and integrin binding family member 2
• DNA-dependent protein kinase catalytic subunit-interacting protein 2
• Kinase-interacting protein 2
• KIP 2
• KIP2calcium and integrin-binding family member 2

Background

The amino acid sequence the protein encoded by this gene is similar to that of KIP/CIB, calcineurin B, and calmodulin. This suggests that the encoded protein may be a Ca2+-binding regulatory protein that interacts with DNA-dependent protein kinase catalytic subunit (DNA-PKcs).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CIB2 Antibody (H00010518-A01)(2)

Publications using H00010518-A01

• Czeredys M, Gruszczynska-Biegala J, Schacht T et al. Expression of genes encoding the calcium signalosome in cellular and transgenic models of Huntington's disease. Front Mol Neurosci. 2013 [PMID: 24324398]
• Riazuddin S, Belyantseva IA, Giese AP et al. Alterations of the CIB2 calcium- and integrin-binding protein cause Usher syndrome type 1J and nonsyndromic deafness DFNB48. Nat Genet. 2012 Nov [PMID: 23023331]

Review for CIB2 Antibody (H00010518-A01) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Other.

reviewed by: Verified Customer IF Other 04/09/2016

Summary

• Application: Immunofluorescence
• Sample Tested: Retina
• Species: Other

Blocking

• Blocking Details: PBSTx + 2.5% BSA + 2.5% FCS at room temperature for at least 30 min

Primary Anitbody

• Dilution Ratio: primary antibody was diluted 1:50 in blocking solution and incubation was done overnight at 4C with rocking

Secondary Antibody

• Secondary Description: donkey-anti mouse Alexa Fluor 594
• Secondary Manufacturer Cat#: A-21203
• Secondary Concentration: 1:200

Details

• Detection Notes: Confocal microscope, Zeiss 510, Z-stack. Negative control was done in the absence of primary antibody.
• Fixation Details: Fish were dehydrated with increasing concentrations of MeOH in PBSTx (PBS 0.1% Triton X-100).
• Wash Description: Three washes were done with PBSTx for 10 min at room temperature with rocking.

Bioinformatics

• Gene Symbol: CIB2
• Entrez:
  • 10518(Human)
• OMIM:
  • 605564(Human)
• Uniprot:
  • NP_006374(Human)