Home » CIB2 » CIB2 Antibodies » CIB2 Antibody

CIB2 Antibody

 (2 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CIB2 Antibody [H00010518-A01] - Detection against Immunogen (37 KDa).
Western Blot: CIB2 Antibody [H00010518-A01] - Detection against Immunogen (37 KDa).
Chromatin Immunoprecipitation: CIB2 Antibody [H00010518-A01] - Analysis of CIB2 in 5dpf zebrafish retina using anti-CIB2 antibody (red) and DAPI (blue). Image from verified customer review.

Product Details

Summary
Reactivity Hu, ZeSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CIB2 Antibody Summary

Immunogen
CIB2 (NP_006374, 1 a.a. - 99 a.a.) partial recombinant protein with GST tag. MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLC
Specificity
CIB2 - calcium and integrin binding family member 2
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CIB2
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500
Reviewed Applications
Read 1 Review rated 4
using
H00010518-A01 in the following applications:
Publications
Read Publications using H00010518-A01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CIB2 Antibody

  • 2810434I23Rik
  • calcium and integrin binding family member 2
  • DNA-dependent protein kinase catalytic subunit-interacting protein 2
  • Kinase-interacting protein 2
  • KIP 2
  • KIP2calcium and integrin-binding family member 2

Background

The amino acid sequence the protein encoded by this gene is similar to that of KIP/CIB, calcineurin B, and calmodulin. This suggests that the encoded protein may be a Ca2+-binding regulatory protein that interacts with DNA-dependent protein kinase catalytic subunit (DNA-PKcs).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p57 Kip2 Antibody
NBP1-89917
Western Blot: p57 Kip2 Antibody [NBP1-89917] - Analysis in human placenta tissue.
Immunocytochemistry/Immunofluorescence: p57 Kip2 Antibody [NBP1-89917] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining in human placenta and colon tissues using anti-CDKN1C antibody. Corresponding CDKN1C RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Coronin-1a Antibody
NB110-58867
Western Blot: Coronin-1a Antibody [NB110-58867] - Analysis of tissue lysates using Coronin-1a Antibody, dilution 1:5,000: [1] protein standard, [2] mouse brain, [3] rat brain, [4] cow cerebellum, [5] cow cortex, and [6] pig spinal cord. The strong single band about 55kDa corresponds to the Coronin-1a protein.
Immunocytochemistry/Immunofluorescence: Coronin-1a Antibody [NB110-58867] - Analysis of cortical neuron-glial cell culture from E20 rat stained with Coronin-1a Antibody, dilution 1:1,000 (Red), and costained with mouse mAb to GFAP, dilution 1:1,000 (Green). Hoechst staining of nuclear DNA (Blue). The Coronin-1a Antibody labels protein expressed in the cytoplasm of microglia cells, while GFAP antibody stains intermediate filaments in astrocytic cells.
(2 Publications)
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(13 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
p27/Kip1 [p
Thr157] Antibody
AF1555
Western blot shows lysates of MCF-7 human breast cancer cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF-I (Catalog # 291‑G1) for 20 minutes. PVDF membrane was probed with 0.5 µg/mL Human Phospho-p27/Kip1 (T157) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1555) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-p27/Kip1 (T157) was detected at approximately 27 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for 1 hour. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(12 Publications)
Species: Hu
Applications: WB
CIB1 Antibody
(791119) [Unconjugate
MAB7557
Western blot shows lysates of human kidney tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human CIB1 Monoclonal Antibody (Catalog # MAB7557) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for CIB1 at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
CIB1 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Mouse Anti-Human CIB1 Monoclonal Antibody (Catalog # MAB7557) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of cancer cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC
TMED7 Antibody
NBP1-90949
Western Blot: TMED7 Antibody [NBP1-90949] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: TMED7 Antibody [NBP1-90949] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Dynactin 6 Antibody
NBP1-80616
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Dynactin 6 Antibody [NBP1-80616] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Western Blot: Dynactin 6 Antibody [NBP1-80616] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
SSSCA1 Antibody
(OTI2F5)
NBP2-03198
Western Blot: SSSCA1 Antibody (OTI2F5) [NBP2-03198] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SSSCA1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SSSCA1.
Immunocytochemistry/Immunofluorescence: SSSCA1 Antibody (OTI2F5) [NBP2-03198] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY SSSCA1.
Immunohistochemistry-Paraffin: SSSCA1 Antibody (OTI2F5) [NBP2-03198] - Staining of paraffin-embedded Human lymph node tissue within the normal limits using anti-SSSCA1 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
IFI27 Antibody
NB300-709
IFI27 Antibody
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
26S proteasome
subunit 9 Antibody
NBP2-47560
Western Blot: 26S proteasome subunit 9 Antibody [NBP2-47560] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line MCF-7
Immunocytochemistry/Immunofluorescence: 26S proteasome subunit 9 Antibody [NBP2-47560] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 26S proteasome subunit 9 Antibody [NBP2-47560] - Staining of human liver.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
D4S234E Antibody
(1C3)
H00027065-M01
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3 Analysis of D4S234E expression in IMR-32.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
SLC12A9 Antibody
NBP2-68858
Immunohistochemistry-Paraffin: SLC12A9 Antibody [NBP2-68858] - Staining of human small intestine shows strong positivity in subsets of immune cells.
Species: Hu
Applications: IHC, IHC-P
CDK2 Antibody
(OTI2D9)
NBP2-00776
Western Blot: Cdk2 Antibody (2D9) [NBP2-00776] Analysis of extracts (35ug) from 9 different cell lines by using anti-Cdk2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: Cdk2 Antibody (2D9) [NBP2-00776] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Cdk2.
Immunohistochemistry-Paraffin: Cdk2 Antibody (2D9) [NBP2-00776] - Staining of paraffin-embedded Carcinoma of Human lung tissue using anti-Cdk2 mouse monoclonal antibody.
(1 Review)
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
IGF-II/IGF2
[Unconjugated]
292-G2
1 μg/lane of Recombinant Human IGF‑II/IGF2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-II/IGF2 (Catalog # 292‑G2) stimulates cell proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 1.5‑6 ng/mL.
(1 Review)
(35 Publications)
Species: Hu
p15INK4b/CDKN2B
Antibody (651308) [Un ...
MAB6798
Western blot shows lysates of 293T human embryonic kidney cell line and HeLa human cervical epithelial carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human p15INK4b/CDKN2B Monoclonal Antibody (Catalog # MAB6798) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for p15INK4b/CDKN2B at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
p15INK4b/CDKN2B was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human p15INK4b/CDKN2B Monoclonal Antibody (Catalog # MAB6798) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, ICC
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(27 Publications)
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for CIB2 Antibody (H00010518-A01)(2)


Review for CIB2 Antibody (H00010518-A01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Other.

Reviews using H00010518-A01:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Other
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence CIB2 H00010518-A01
Enlarge
reviewed by:
Anonymous
 IF Other 04/09/2016
View

Summary

ApplicationImmunofluorescence
Sample TestedRetina
SpeciesOther

Blocking

Blocking DetailsPBSTx + 2.5% BSA + 2.5% FCS at room temperature for at least 30 min

Primary Anitbody

Dilution Ratioprimary antibody was diluted 1:50 in blocking solution and incubation was done overnight at 4C with rocking

Secondary Antibody

Secondary Descriptiondonkey-anti mouse Alexa Fluor 594
Secondary Manufacturer Cat#A-21203
Secondary Concentration1:200

Details

Detection NotesConfocal microscope, Zeiss 510, Z-stack. Negative control was done in the absence of primary antibody.
Fixation DetailsFish were dehydrated with increasing concentrations of MeOH in PBSTx (PBS 0.1% Triton X-100).
Wash DescriptionThree washes were done with PBSTx for 10 min at room temperature with rocking.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CIB2 Antibody (H00010518-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CIB2 Products

Bioinformatics Tool for CIB2 Antibody (H00010518-A01)

Discover related pathways, diseases and genes to CIB2 Antibody (H00010518-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIB2 Antibody (H00010518-A01)

Discover more about diseases related to CIB2 Antibody (H00010518-A01).
 

Pathways for CIB2 Antibody (H00010518-A01)

View related products by pathway.

Research Areas for CIB2 Antibody (H00010518-A01)

Find related products by research area.

Blogs on CIB2

There are no specific blogs for CIB2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Immunofluorescence CIB2 H00010518-A01
Enlarge
 Anonymous
04/09/2016
Application: IF
Species: Other
read this review

Bioinformatics

Gene Symbol CIB2
Entrez
OMIM
Uniprot