Recombinant Human CHSY1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CHSY1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 516-624 of Human CHSY1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTCLIPNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQILPVSGEFSRALALEVGSSQFNNE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CHSY1

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHSY1 Protein

  • Chondroitin glucuronyltransferase 1
  • chondroitin glucuronyltransferase II
  • chondroitin sulfate synthase 1
  • Chondroitin synthase 1
  • CHSY
  • ChSy-1
  • CSS1DKFZp434M032
  • EC 2.4.1.175
  • EC 2.4.1.226
  • FLJ58581
  • Glucuronosyl-N-acetylgalactosaminyl-proteoglycan4-beta-N-acetylgalactosaminyltransferase 1
  • KIAA0990carbohydrate (chondroitin) synthase 1
  • N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 1
  • N-acetylgalactosaminyltransferase 1
  • N-acetylgalactosaminyltransferase II

Background

CHSY1 synthesizes chondroitin sulfate, a glycosaminoglycan expressed on the surface of most cells and in extracellular matrices. Glycosaminoglycan chains are covalently linked to a wide range of core protein families and regulate many biologic processes, including cell proliferation and recognition, extracellular matrix deposition, and morphogenesis.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79818
Species: Hu
Applications: WB
NBP1-85626
Species: Hu
Applications: IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87810
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1414
Species: Hu
Applications: WB, PEP-ELISA
NBP2-45889
Species: Hu
Applications: WB, IHC
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP2-15675
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000826-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi

Publications for CHSY1 Partial Recombinant Protein (H00022856-Q01) (0)

There are no publications for CHSY1 Partial Recombinant Protein (H00022856-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHSY1 Partial Recombinant Protein (H00022856-Q01) (0)

There are no reviews for CHSY1 Partial Recombinant Protein (H00022856-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHSY1 Partial Recombinant Protein (H00022856-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHSY1 Products

CHSY1 H00022856-Q01

Bioinformatics Tool for CHSY1 Partial Recombinant Protein (H00022856-Q01)

Discover related pathways, diseases and genes to CHSY1 Partial Recombinant Protein (H00022856-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHSY1 Partial Recombinant Protein (H00022856-Q01)

Discover more about diseases related to CHSY1 Partial Recombinant Protein (H00022856-Q01).
 

Pathways for CHSY1 Partial Recombinant Protein (H00022856-Q01)

View related products by pathway.

Blogs on CHSY1

There are no specific blogs for CHSY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CHSY1 Antibody
NBP2-15899

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHSY1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHSY1