Recombinant Human CHRND Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CHRND Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-107 of Human CHRND partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CHRND

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHRND Protein

  • acetylcholine receptor subunit delta
  • ACHRDSCCMS
  • cholinergic receptor, nicotinic, delta polypeptide
  • cholinergic receptor, nicotinic, delta
  • CMS2A
  • FCCMS

Background

CHRND - cholinergic receptor, nicotinic, delta polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79952
Species: Hu
Applications: WB
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57262
Species: Hu
Applications: ICC/IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84478
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB120-11099
Species: Hu, Mu, Rt, Po, Al, Am, Av, Bv, Ch, Fi, Rb
Applications: WB, ICC/IF
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02073
Species: Hu, Mu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-79951
Species: Hu
Applications: WB
NB600-594
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for CHRND Partial Recombinant Protein (H00001144-Q01) (0)

There are no publications for CHRND Partial Recombinant Protein (H00001144-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHRND Partial Recombinant Protein (H00001144-Q01) (0)

There are no reviews for CHRND Partial Recombinant Protein (H00001144-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHRND Partial Recombinant Protein (H00001144-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHRND Products

Bioinformatics Tool for CHRND Partial Recombinant Protein (H00001144-Q01)

Discover related pathways, diseases and genes to CHRND Partial Recombinant Protein (H00001144-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHRND Partial Recombinant Protein (H00001144-Q01)

Discover more about diseases related to CHRND Partial Recombinant Protein (H00001144-Q01).
 

Pathways for CHRND Partial Recombinant Protein (H00001144-Q01)

View related products by pathway.

PTMs for CHRND Partial Recombinant Protein (H00001144-Q01)

Learn more about PTMs related to CHRND Partial Recombinant Protein (H00001144-Q01).
 

Research Areas for CHRND Partial Recombinant Protein (H00001144-Q01)

Find related products by research area.

Blogs on CHRND

There are no specific blogs for CHRND, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NF-L Antibody
NB300-131

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHRND Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRND