Chondroitin sulfate synthase 3 Recombinant Protein Antigen

Images

 
There are currently no images for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Chondroitin sulfate synthase 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHSY3.

Source: E. coli

Amino Acid Sequence: LVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHSY3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85626.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Chondroitin sulfate synthase 3 Recombinant Protein Antigen

  • Carbohydrate synthase 2
  • Chondroitin glucuronyltransferase 3
  • chondroitin sulfate synthase 3
  • Chondroitin synthase 2
  • chondroitin synthase-2
  • CHSY2
  • chSy-2
  • CSS3N-acetylgalactosaminyltransferase 3
  • EC 2.4.1.175
  • EC 2.4.1.226
  • Glucuronosyl-N-acetylgalactosaminyl-proteoglycan4-beta-N-acetylgalactosaminyltransferase II
  • N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 3

Background

Chondroitin sulfate synthases (CHSYs) synthesize chondroitin sulfate, a glycosaminoglycan expressed on the surface of most cells and in extracellular matrices. Glycosaminoglycan chains are covalently linked to various of core protein families and regulate many biologic processes, including extracellular matrix deposition, cell proliferation and recognition, and morphogenesis. The CHSY family includes CHSY1, CHSY2 and CHSY3. CHSY1 and CHSY3 display both glucuronyltransferase and N-acetylgalactosaminyltransferase activities, while CHSY2 is required for chondroitin polymerizing activity. CHSY2 localizes to the Golgi apparatus and is expressed ubiquitously, with highest expression observed in pancreas, ovary, brain, heart, skeletal muscle, colon, kidney, liver, stomach, small intestine and placenta.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88086
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-13878
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47604
Species: Hu, Mu, Rt, Ze
Applications: ELISA, IHC, WB
MAB26291
Species: Mu
Applications: IHC
NBP1-88087
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-03414
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1227
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
H00000826-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, PLA, S-ELISA, WB
H00084000-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
352-MS
Species: Hu
Applications: BA
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00050515-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
NB110-92756
Species: Ch, Hu, Mu, Re
Applications: KD, WB
NBP2-56333
Species: Hu
Applications: ICC/IF, WB

Publications for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP) (0)

There are no publications for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP) (0)

There are no reviews for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Chondroitin sulfate synthase 3 Protein (NBP1-85626PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Chondroitin sulfate synthase 3 Products

Blogs on Chondroitin sulfate synthase 3

There are no specific blogs for Chondroitin sulfate synthase 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Chondroitin sulfate synthase 3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHSY3